• Gene id: 64968

Gene Summary

• Gene Symbol: MRPS6   Gene   UCSC   Ensembl
• Aliases: C21orf101, MRP-S6, RPMS6, S6mt
• Gene name: mitochondrial ribosomal protein S6
• Alternate names: 28S ribosomal protein S6, mitochondrial, mitochondrial small ribosomal subunit protein bS6m,
• Gene location: 21q22.11 (34073577: 34143029)     Exons: 3     NC_000021.9
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Protein Summary

• Protein general information: P82932  
  • Name: 28S ribosomal protein S6, mitochondrial (MRP S6) (S6mt) (Mitochondrial small ribosomal subunit protein bS6m)
  • Length: 125  
  • Mass: 14227
• Sequence:

  MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAV
  ESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

• Structural information:
  • Interpro: IPR000529  IPR035980  IPR014717  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000382250
• Other Databases: GeneCards:  MRPS6  Malacards:  MRPS6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005763	mitochondrial small ribosomal subunit	IBA	cellular component
GO:0070181	small ribosomal subunit rRNA binding	IBA	molecular function
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0019843	rRNA binding	IEA	molecular function
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0015935	small ribosomal subunit	NAS	cellular component
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0006412	translation	NAS	biological process
GO:0032543	mitochondrial translation	ISS	biological process
GO:0005763	mitochondrial small ribosomal subunit	ISS	cellular component
GO:0003735	structural constituent of ribosome	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq