• Gene id: 64963

Gene Summary

• Gene Symbol: MRPS11   Gene   UCSC   Ensembl
• Aliases: HCC-2, MRP-S11, S11mt
• Gene name: mitochondrial ribosomal protein S11
• Alternate names: 28S ribosomal protein S11, mitochondrial, cervical cancer proto-oncogene 2 protein, mitochondrial small ribosomal subunit protein uS11m,
• Gene location: 15q25.3 (118062429: 118032686)     Exons: 11     NC_000012.12
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611977

Protein Summary

• Protein general information: P82912  
  • Name: 28S ribosomal protein S11, mitochondrial (MRP S11) (S11mt) (Cervical cancer proto oncogene 2 protein) (HCC 2) (Mitochondrial small ribosomal subunit protein uS11m)
  • Length: 194  
  • Mass: 20616
• Sequence:

  MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRW
  AGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVV
  VKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL

• Structural information:
  • Interpro: IPR001971  IPR018102  IPR036967  
  • Prosite: PS00054
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000317376
• Other Databases: GeneCards:  MRPS11  Malacards:  MRPS11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048027	mRNA 5'-UTR binding	IBA	molecular function
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0000028	ribosomal small subunit assembly	IBA	biological process
GO:0070181	small ribosomal subunit rRNA binding	IBA	molecular function
GO:0006412	translation	IBA	biological process
GO:0005763	mitochondrial small ribosomal subunit	IBA	cellular component
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0042769	DNA damage response, detection of DNA damage	NAS	biological process
GO:0005763	mitochondrial small ribosomal subunit	ISS	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0032543	mitochondrial translation	ISS	biological process
GO:0003735	structural constituent of ribosome	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray