• Gene id: 64960

Gene Summary

• Gene Symbol: MRPS15   Gene   UCSC   Ensembl
• Aliases: DC37, MPR-S15, RPMS15, S15mt
• Gene name: mitochondrial ribosomal protein S15
• Alternate names: 28S ribosomal protein S15, mitochondrial, MRP-S15, mitochondrial small ribosomal subunit protein uS15m,
• Gene location: 1p34.3 (36464383: 36455717)     Exons: 8     NC_000001.11
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611979

Protein Summary

• Protein general information: P82914  
  • Name: 28S ribosomal protein S15, mitochondrial (MRP S15) (S15mt) (Mitochondrial small ribosomal subunit protein uS15m)
  • Length: 257  
  • Mass: 29842
• Sequence:

  MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKD
  YQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDK
  AHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRR
  ALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ

• Structural information:
  • Interpro: IPR000589  IPR005290  IPR009068  
  • CDD: cd00353
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000362208
• Other Databases: GeneCards:  MRPS15  Malacards:  MRPS15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005761	mitochondrial ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0006412	translation	NAS	biological process
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0032543	mitochondrial translation	ISS	biological process
GO:0003735	structural constituent of ribosome	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray