• Gene id: 64951

Gene Summary

• Gene Symbol: MRPS24   Gene   UCSC   Ensembl
• Aliases: HSPC335, MRP-S24, S24mt, bMRP-47, bMRP47
• Gene name: mitochondrial ribosomal protein S24
• Alternate names: 28S ribosomal protein S24, mitochondrial, mitochondrial 28S ribosomal protein S24, mitochondrial small ribosomal subunit protein uS3m,
• Gene location: 7p13 (43869516: 43866557)     Exons: 4     NC_000007.14
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611986

Protein Summary

• Protein general information: Q96EL2  
  • Name: 28S ribosomal protein S24, mitochondrial (MRP S24) (S24mt) (Mitochondrial small ribosomal subunit protein uS3m) (bMRP 47) (bMRP47)
  • Length: 167  
  • Mass: 19015
• Sequence:

  MAASVCSGLLGPRVLSWSRELPCAWRALHTSPVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGN
  LDGEDHAAERTVEDVFLRKFMWGTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCP
  VRLHLQTVPSKVVYKYL

• Structural information:
  • Interpro: IPR026146  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000318158
• Other Databases: GeneCards:  MRPS24  Malacards:  MRPS24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005763	mitochondrial small ribosomal subunit	ISS	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003735	structural constituent of ribosome	ISS	molecular function
GO:0032543	mitochondrial translation	ISS	biological process
GO:0005763	mitochondrial small ribosomal subunit	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881