• Gene id: 64949

Gene Summary

• Gene Symbol: MRPS26   Gene   UCSC   Ensembl
• Aliases: C20orf193, GI008, MRP-S13, MRP-S26, MRPS13, NY-BR-87, RPMS13, dJ534B8.3
• Gene name: mitochondrial ribosomal protein S26
• Alternate names: 28S ribosomal protein S26, mitochondrial, 28S ribosomal protein S13, mitochondrial, S13mt, S26mt, mitochondrial small ribosomal subunit protein mS26, serologically defined breast cancer antigen NY-BR-87,
• Gene location: 20p13 (3046051: 3048249)     Exons: 4     NC_000020.11
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611988

Protein Summary

• Protein general information: Q9BYN8  
  • Name: 28S ribosomal protein S26, mitochondrial (MRP S26) (S26mt) (28S ribosomal protein S13, mitochondrial) (MRP S13) (S13mt) (Mitochondrial small ribosomal subunit protein mS26)
  • Length: 205  
  • Mass: 24212
• Sequence:

  MLRALSRLGAGTPCRPRAPLVLPARGRKTRHDPLAKSKIERVNMPPAVDPAEFFVLMERYQHYRQTVRALRMEFV
  SEVQRKVHEARAGVLAERKALKDAAEHRELMAWNQAENRRLHELRIARLRQEEREQEQRQALEQARKAEEVQAWA
  QRKEREVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS

• Structural information:
  • Interpro: IPR026140  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000369682
• Other Databases: GeneCards:  MRPS26  Malacards:  MRPS26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IBA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0042769	DNA damage response, detection of DNA damage	NAS	biological process
GO:0005763	mitochondrial small ribosomal subunit	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray