• Gene id: 64946

Gene Summary

• Gene Symbol: CENPH   Gene   UCSC   Ensembl
• Gene name: centromere protein H
• Alternate names: centromere protein H, CENP-H, interphase centromere complex protein 35, kinetochore protein CENP-H,
• Gene location: 5q13.2 (69189582: 69210356)     Exons: 9     NC_000005.10
• Gene summary(Entrez): Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interpha
• OMIM: 146650

Protein Summary

• Protein general information: Q9H3R5  
  • Name: Centromere protein H (CENP H) (Interphase centromere complex protein 35)
  • Length: 247  
  • Mass: 28481
• Sequence:

  MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQE
  KQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDL
  EEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKV
  NWAEDPALKEIVLQLEKNVDMM

• Structural information:
  • Interpro: IPR040034  IPR008426  
  • STRING: ENSP00000283006
• Other Databases: GeneCards:  CENPH  Malacards:  CENPH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043515	kinetochore binding	IBA	molecular function
GO:0007052	mitotic spindle organization	IBA	biological process
GO:0000776	kinetochore	IBA	cellular component
GO:0007059	chromosome segregation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0051382	kinetochore assembly	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000776	kinetochore	IEA	cellular component
GO:0043515	kinetochore binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0043515	kinetochore binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0051383	kinetochore organization	TAS	biological process
GO:0000776	kinetochore	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000776	kinetochore	IMP	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray