• Gene id: 6494

Gene Summary

• Gene Symbol: SIPA1   Gene   UCSC   Ensembl
• Aliases: SPA1
• Gene name: signal-induced proliferation-associated 1
• Alternate names: signal-induced proliferation-associated protein 1, GTPase-activating protein Spa-1, p130 SPA-1, signal-induced proliferation-associated gene 1, sipa-1,
• Gene location: 11q13.1 (65638100: 65650929)     Exons: 18     NC_000011.10
• Gene summary(Entrez): The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell
• OMIM: 600211

Protein Summary

• Protein general information: Q96FS4  
  • Name: Signal induced proliferation associated protein 1 (Sipa 1) (GTPase activating protein Spa 1) (p130 SPA 1)
  • Length: 1042  
  • Mass: 112149
  • Tissue specificity: Expressed in fetal as well as in adult tissues. Expressed abundantly in the lymphoid tissues such as thymus, spleen and peripheral blood lymphocytes and also shows a significant expression in the spinal cord.
• Sequence:

  MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPVRGPLLRSGSDAGEARPPTPASPRARAHSH
  EEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYDVQSLLFDWAPRSQGMGSHSEASSGTLASAE
  DQAASSDLLHGAPGFVCELGGEGELGLGGPASPPVPPALPNAAVSILEEPQNRTSAYSLEHADLGAGYYRKYFYG
  KEHQNFFGMDESLGPVAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVA
  PQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGPAFMQFLTLLGDVVRLKG
  FESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQQLLRKRHIGNDIVTIVFQEPGSKPFCPTTI
  RSHFQHVFLVVRAHTPCTPHTTYRVAVSRTQDTPAFGPALPAGGGPFAANADFRAFLLAKALNGEQAAGHARQFH
  AMATRTRQQYLQDLATNEVTTTSLDSASRFGLPSLGGRRRAAPRGPGAELQAAGSLVWGVRAAPGARVAAGAQAS
  GPEGIEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQQLDLYHGRGEAITLRFDGSPGQAVGEVVAR
  LQLVSRGCETRELALPRDGQGRLGFEVDAEGFVTHVERFTFAETAGLRPGARLLRVCGQTLPSLRPEAAAQLLRS
  APKVCVTVLPPDESGRPRRSFSELYTLSLQEPSRRGAPDPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPGPGDLA
  EERTEFLHSQNSLSPRSSLSDEAPVLPNTTPDLLLATTAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRA
  SFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLS
  EKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA

• Structural information:
  • Protein Domains: (321..53-)
    (/note="Rap-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00165-)
    (687..76-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143"-)
  • Interpro: IPR001478  IPR036034  IPR035974  IPR000331  
  • Prosite: PS50106 PS50085
  • STRING: ENSP00000377771
• Other Databases: GeneCards:  SIPA1  Malacards:  SIPA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051056	regulation of small GTPase mediated signal transduction	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0042631	cellular response to water deprivation	IEA	biological process
GO:0030133	transport vesicle	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0005096	GTPase activator activity	NAS	molecular function
GO:0045786	negative regulation of cell cycle	NAS	biological process
GO:0035556	intracellular signal transduction	NAS	biological process
GO:0007162	negative regulation of cell adhesion	NAS	biological process
GO:0030308	negative regulation of cell growth	NAS	biological process
GO:0007010	cytoskeleton organization	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04015	Rap1 signaling pathway
hsa04670	Leukocyte transendothelial migration

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881