• Gene id: 64927

Gene Summary

• Gene Symbol: TTC23   Gene   UCSC   Ensembl
• Aliases: HCC-8
• Gene name: tetratricopeptide repeat domain 23
• Alternate names: tetratricopeptide repeat protein 23, TPR repeat protein 23, cervical cancer proto-oncogene 8 protein,
• Gene location: 15q26.3 (99251225: 99136322)     Exons: 23     NC_000015.10
• OMIM: 138970

Protein Summary

• Protein general information: Q5W5X9  
  • Name: Tetratricopeptide repeat protein 23 (TPR repeat protein 23) (Cervical cancer proto oncogene 8 protein) (HCC 8)
  • Length: 447  
  • Mass: 50009
• Sequence:

  MQESQETHISNHLDEVVAAVSITHRKKFQNKLLQTALFQPPREKLHLCEEKAKSYSNSHEYKQAVHELVRCVALT
  RICYGDSHWKLAEAHVNLAQGYLQLKGLSLQAKQHAEKARQILANSIVPPYSENTDVFKFSIELFHTMGRALLSL
  QKFKEAAENLTKAERLSKELLQCGRIIKEEWIEIEARIRLSFAQVYQGQKKSKEALSHYQAALEYVEISKGETSR
  ECVPILRELAGVEQALGLHDVSINHFLQAHLIILSRSPSQVEAADSAHIVAHAAVASGRHEHHDVAEQYFQESMA
  HLKDSEGMGRTKFLSIQDEFCHFLQMTGQKERATSILRESLEAKVEAFGDFSPEVAETYRLLGGADLAQGNHSGA
  RKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIPQDTLLGKARPGTTAD

• Structural information:
  • Interpro: IPR011990  IPR019734  IPR042621  
  • STRING: ENSP00000377690
• Other Databases: GeneCards:  TTC23  Malacards:  TTC23

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005929	cilium	ISS	cellular component
GO:0045880	positive regulation of smoothened signaling pathway	ISS	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0005929	cilium	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq