• Gene id: 64924

Gene Summary

• Gene Symbol: SLC30A5   Gene   UCSC   Ensembl
• Aliases: ZNT5, ZNTL1, ZTL1, ZnT-5
• Gene name: solute carrier family 30 member 5
• Alternate names: zinc transporter 5, solute carrier family 30 (zinc transporter), member 5, zinc transporter ZTL1, znT-like transporter 1,
• Gene location: 5q13.1-q13.2 (39380243: 39428527)     Exons: 14     NC_000021.9
• Gene summary(Entrez): This gene encodes a member of the SLC30A/ZnT family of zinc transporter proteins. ZnT proteins mediate both cellular zinc efflux and zinc sequestration into membrane-bound organelles. The encoded protein plays a role in the early secretory pathway as a he
• OMIM: 607819

Protein Summary

• Protein general information: Q8TAD4  
  • Name: Zinc transporter 5 (ZnT 5) (Solute carrier family 30 member 5) (ZnT like transporter 1) (hZTL1)
  • Length: 765  
  • Mass: 84047
  • Tissue specificity: Ubiquitously expressed. Highly expressed in pancreas, liver and kidney. Expressed abundantly in insulin-containing beta cells, undetectable in other endocrine cell types including glucagon-secreting alpha cells and most acinar cells. {
• Sequence:

  MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMV
  LFQKPFSSGKTITKHQWIKIFKHAVAGCIISLLWFFGLTLCGPLRTLLLFEHSDIVVISLLSVLFTSSGGGPAKT
  RGAAFFIIAVICLLLFDNDDLMAKMAEHPEGHHDSALTHMLYTAIAFLGVADHKGGVLLLVLALCCKVGFHTASR
  KLSVDVGGAKRLQALSHLVSVLLLCPWVIVLSVTTESKVESWFSLIMPFATVIFFVMILDFYVDSICSVKMEVSK
  CARYGSFPIFISALLFGNFWTHPITDQLRAMNKAAHQESTEHVLSGGVVVSAIFFILSANILSSPSKRGQKGTLI
  GYSPEGTPLYNFMGDAFQHSSQSIPRFIKESLKQILEESDSRQIFYFLCLNLLFTFVELFYGVLTNSLGLISDGF
  HMLFDCSALVMGLFAALMSRWKATRIFSYGYGRIEILSGFINGLFLIVIAFFVFMESVARLIDPPELDTHMLTPV
  SVGGLIVNLIGICAFSHAHSHAHGASQGSCHSSDHSHSHHMHGHSDHGHGHSHGSAGGGMNANMRGVFLHVLADT
  LGSIGVIVSTVLIEQFGWFIADPLCSLFIAILIFLSVVPLIKDACQVLLLRLPPEYEKELHIALEKIQKIEGLIS
  YRDPHFWRHSASIVAGTIHIQVTSDVLEQRIVQQVTGILKDAGVNNLTIQVEKEAYFQHMSGLSTGFHDVLAMTK
  QMESMKYCKDGTYIM

• Structural information:
  • Interpro: IPR002524  IPR027469  
  • STRING: ENSP00000379836
• Other Databases: GeneCards:  SLC30A5  Malacards:  SLC30A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0006812	cation transport	IEA	biological process
GO:0008324	cation transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0006829	zinc ion transport	IEA	biological process
GO:0030141	secretory granule	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005385	zinc ion transmembrane transporter activity	IDA	molecular function
GO:0005385	zinc ion transmembrane transporter activity	IDA	molecular function
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0006829	zinc ion transport	IDA	biological process
GO:0006824	cobalt ion transport	IDA	biological process
GO:0006824	cobalt ion transport	IDA	biological process
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0005385	zinc ion transmembrane transporter activity	TAS	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0071577	zinc ion transmembrane transport	IEA	biological process
GO:0071577	zinc ion transmembrane transport	IEA	biological process
GO:0071577	zinc ion transmembrane transport	IEA	biological process
GO:0071577	zinc ion transmembrane transport	IEA	biological process
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0006829	zinc ion transport	IDA	biological process
GO:0006882	cellular zinc ion homeostasis	IDA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IDA	molecular function
GO:0010043	response to zinc ion	IDA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0008270	zinc ion binding	NAS	molecular function
GO:0010155	regulation of proton transport	NAS	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R