• Gene id: 64895

Gene Summary

• Gene Symbol: PAPOLG   Gene   UCSC   Ensembl
• Gene name: poly(A) polymerase gamma
• Alternate names: poly(A) polymerase gamma, PAP-gamma, SRP RNA 3' adenylating enzyme/pap2, SRP RNA 3'-adenylating enzyme, SRP RNA-adenylating enzyme, neo-PAP, neo-poly(A) polymerase, nuclear poly(A) polymerase gamma, polynucleotide adenylyltransferase gamma, signal recognition part,
• Gene location: 2p16.1 (60756247: 60802085)     Exons: 4     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the poly(A) polymerase family which catalyzes template-independent extension of the 3' end of a DNA/RNA strand. This enzyme shares 60% identity to the well characterized poly(A) polymerase II (PAPII) at the amino acid level.
• OMIM: 616865

Protein Summary

• Protein general information: Q9BWT3  
  • Name: Poly(A) polymerase gamma (PAP gamma) (EC 2.7.7.19) (Neo poly(A) polymerase) (Neo PAP) (Polynucleotide adenylyltransferase gamma) (SRP RNA 3' adenylating enzyme) (Signal recognition particle RNA adenylating enzyme) (SRP RNA adenylating enzyme)
  • Length: 736  
  • Mass: 82803
  • Tissue specificity: Expressed predominantly in testis, and weakly in other tissues. Overexpressed in several tumors. {ECO
• Sequence:

  MKEMSANTVLDSQRQQKHYGITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWI
  SDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVED
  AFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRA
  VKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWD
  PRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIV
  LTASASTEENHLEWVGLVESKIRVLVGNLERNEFITLAHVNPQSFPGNKEHHKDNNYVSMWFLGIIFRRVENAES
  VNIDLTYDIQSFTDTVYRQANNINMLKEGMKIEATHVKKKQLHHYLPAEILQKKKKQSLSDVNRSSGGLQSKRLS
  LDSSCLDSSRDTDNGTPFNSPASKSDSPSVGETERNSAEPAAVIVEKPLSVPPAQGLSIPVIGAKVDSTVKTVSP
  PTVCTIPTVVGRNVIPRITTPHNPAQGQPHLNGMSNITKTVTPKRSHSPSIDGTPKRLKDVEKFIRLESTFKDPR
  TAEERKRKSVDAIGGESMPIPTIDTSRKKRLPSKELPDSSSPVPANNIRVIKNSIRLTLNR

• Structural information:
  • Interpro: IPR011068  IPR007012  IPR007010  IPR002934  
  • PDB: 4LT6
  • PDBsum: 4LT6
  • STRING: ENSP00000238714
• Other Databases: GeneCards:  PAPOLG  Malacards:  PAPOLG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006378	mRNA polyadenylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004652	polynucleotide adenylyltransferase activity	IBA	molecular function
GO:0046872	metal ion binding	IDA	molecular function
GO:0043631	RNA polyadenylation	IDA	biological process
GO:0043631	RNA polyadenylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0004652	polynucleotide adenylyltransferase activity	IDA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0031123	RNA 3'-end processing	IEA	biological process
GO:0043631	RNA polyadenylation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881