• Gene id: 6489

Gene Summary

• Gene Symbol: ST8SIA1   Gene   UCSC   Ensembl
• Aliases: GD3S, SIAT8, SIAT8-A, SIAT8A, ST8SiaI
• Gene name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
• Alternate names: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase, ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 1, alpha-2,8-sialyltransferase 8A, disialoganglioside (GD3) synthase, ganglioside GD3 synthase, ganglioside GT3 synthase, ganglioside-specific alpha,
• Gene location: 12p12.1 (22334713: 22193390)     Exons: 5     NC_000012.12
• Gene summary(Entrez): Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the

Protein Summary

• Protein general information: Q92185  
  • Name: Alpha N acetylneuraminide alpha 2,8 sialyltransferase (EC 2.4.99.8) (Alpha 2,8 sialyltransferase 8A) (Ganglioside GD3 synthase) (Ganglioside GT3 synthase) (Sialyltransferase 8A) (SIAT8 A) (Sialyltransferase St8Sia I) (ST8SiaI)
  • Length: 356  
  • Mass: 40519
  • Tissue specificity: Strongly expressed in melanoma cell lines, adult and fetal brain and to a lesser extent in adult and fetal lung. {ECO
• Sequence:

  MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAA
  RAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKS
  GCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSM
  KTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSV
  NMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • STRING: ENSP00000379353
• Other Databases: GeneCards:  ST8SIA1  Malacards:  ST8SIA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006491	N-glycan processing	IBA	biological process
GO:0006486	protein glycosylation	IBA	biological process
GO:0009311	oligosaccharide metabolic process	IBA	biological process
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008373	sialyltransferase activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0006688	glycosphingolipid biosynthetic process	TAS	biological process
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0034605	cellular response to heat	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0006491	N-glycan processing	IBA	biological process
GO:0006486	protein glycosylation	IBA	biological process
GO:0009311	oligosaccharide metabolic process	IBA	biological process
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008373	sialyltransferase activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0006688	glycosphingolipid biosynthetic process	TAS	biological process
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0034605	cellular response to heat	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00601	Glycosphingolipid biosynthesis - lacto and neolacto series
hsa00603	Glycosphingolipid biosynthesis - globo and isoglobo series
hsa00604	Glycosphingolipid biosynthesis - ganglio series

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881