• Gene id: 64863

Gene Summary

• Gene Symbol: METTL4   Gene   UCSC   Ensembl
• Aliases: HsT661
• Gene name: methyltransferase like 4
• Alternate names: N(6)-adenine-specific methyltransferase METTL4, N(6)-adenine-specific DNA methyltransferase METTL4, methyltransferase-like protein 4, snRNA (2'-O-methyladenosine-N(6)-)-methyltransferase METTL4,
• Gene location: 18p11.32 (2571504: 2537529)     Exons: 10     NC_000018.10

Protein Summary

• Protein general information: Q8N3J2  
  • Name: N(6) adenine specific methyltransferase METTL4 (Methyltransferase like protein 4) (N(6) adenine specific DNA methyltransferase METTL4) (EC 2.1.1.72) (snRNA (2' O methyladenosine N(6) ) methyltransferase METTL4) (EC 2.1.1. )
  • Length: 472  
  • Mass: 54041
• Sequence:

  MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDD
  GGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEY
  HTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEED
  TSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNR
  YSYLSPLQIQQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKK
  PYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWT
  SWGNEVLKFQHVDYFIAVESGS

• Structural information:
  • Interpro: IPR002052  IPR007757  IPR029063  
  • Prosite: PS51143 PS00092
  • STRING: ENSP00000458290
• Other Databases: GeneCards:  METTL4  Malacards:  METTL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009007	site-specific DNA-methyltransferase (adenine-specific) activity	IBA	molecular function
GO:0008168	methyltransferase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0120049	snRNA (adenine-N6)-methylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0008173	RNA methyltransferase activity	IDA	molecular function
GO:0009007	site-specific DNA-methyltransferase (adenine-specific) activity	ISS	molecular function
GO:0043484	regulation of RNA splicing	IMP	biological process
GO:1902275	regulation of chromatin organization	ISS	biological process
GO:0032775	DNA methylation on adenine	ISS	biological process
GO:0032259	methylation	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0009007	site-specific DNA-methyltransferase (adenine-specific) activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0001510	RNA methylation	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray