• Gene id: 64859

Gene Summary

• Gene Symbol: NABP1   Gene   UCSC   Ensembl
• Aliases: OBFC2A, SOSS-B2, SSB2
• Gene name: nucleic acid binding protein 1
• Alternate names: SOSS complex subunit B2, oligonucleotide/oligosaccharide-binding fold containing 2A, oligonucleotide/oligosaccharide-binding fold-containing protein 2A, sensor of single-strand DNA complex subunit B2, sensor of ssDNA subunit B2, single-stranded DNA-binding pro,
• Gene location: 2q32.3 (191678071: 191690666)     Exons: 7     NC_000002.12
• Gene summary(Entrez): Single-stranded DNA (ssDNA)-binding proteins, such as OBFC2A, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage (Richard et al., 2008 [PubMed 18449195]).[supplie
• OMIM: 612103

Protein Summary

• Protein general information: Q96AH0  
  • Name: SOSS complex subunit B2 (Nucleic acid binding protein 1) (Oligonucleotide/oligosaccharide binding fold containing protein 2A) (Sensor of single strand DNA complex subunit B2) (Sensor of ssDNA subunit B2) (SOSS B2) (Single stranded DNA binding protein 2) (
  • Length: 204  
  • Mass: 22423
• Sequence:

  MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLT
  RGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGN
  GVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR

• Structural information:
  • Interpro: IPR012340  
  • STRING: ENSP00000403683
• Other Databases: GeneCards:  NABP1  Malacards:  NABP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070876	SOSS complex	IBA	cellular component
GO:0007093	mitotic cell cycle checkpoint	IBA	biological process
GO:0010212	response to ionizing radiation	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0000784	nuclear chromosome, telomeric region	IBA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0070876	SOSS complex	IDA	cellular component
GO:0070876	SOSS complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006281	DNA repair	IMP	biological process
GO:0010212	response to ionizing radiation	IMP	biological process
GO:0010212	response to ionizing radiation	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0003697	single-stranded DNA binding	ISS	molecular function
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0000784	nuclear chromosome, telomeric region	IEA	cellular component
GO:0000784	nuclear chromosome, telomeric region	ISS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0007093	mitotic cell cycle checkpoint	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881