• Gene id: 64858

Gene Summary

• Gene Symbol: DCLRE1B   Gene   UCSC   Ensembl
• Aliases: APOLLO, SNM1B, SNMIB
• Gene name: DNA cross-link repair 1B
• Alternate names: 5' exonuclease Apollo, DNA cross-link repair 1B (PSO2 homolog, S. cerevisiae), PSO2 homolog, SNM1 homolog B,
• Gene location: 1p13.2 (113904618: 113914085)     Exons: 5     NC_000001.11
• Gene summary(Entrez): DNA interstrand cross-links prevent strand separation, thereby physically blocking transcription, replication, and segregation of DNA. DCLRE1B is one of several evolutionarily conserved genes involved in repair of interstrand cross-links (Dronkert et al.,
• OMIM: 609683

Protein Summary

• Protein general information: Q9H816  
  • Name: 5' exonuclease Apollo (EC 3.1. . ) (DNA cross link repair 1B protein) (SNM1 homolog B) (SNMIB) (hSNM1B)
  • Length: 532  
  • Mass: 60002
• Sequence:

  MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVG
  ESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCN
  PALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEK
  AGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSR
  RPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKK
  EKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQKRVTMLTAPLGFSVHLRSTDEEFISQKTREE
  IGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQV
  EKYHKPC

• Structural information:
  • Interpro: IPR011084  IPR036866  
  • PDB: 3BUA 5AHO
  • PDBsum: 3BUA 5AHO
  • DIP: 42669
  • STRING: ENSP00000358576
• Other Databases: GeneCards:  DCLRE1B  Malacards:  DCLRE1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008409	5'-3' exonuclease activity	IDA	molecular function
GO:0003684	damaged DNA binding	IBA	molecular function
GO:0031848	protection from non-homologous end joining at telomere	IBA	biological process
GO:0035312	5'-3' exodeoxyribonuclease activity	IBA	molecular function
GO:0006303	double-strand break repair via nonhomologous end joining	IBA	biological process
GO:0036297	interstrand cross-link repair	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0000781	chromosome, telomeric region	IDA	cellular component
GO:0000781	chromosome, telomeric region	IDA	cellular component
GO:0008409	5'-3' exonuclease activity	IDA	molecular function
GO:0008409	5'-3' exonuclease activity	IDA	molecular function
GO:0000723	telomere maintenance	IMP	biological process
GO:0007093	mitotic cell cycle checkpoint	IMP	biological process
GO:0031860	telomeric 3' overhang formation	ISS	biological process
GO:0031848	protection from non-homologous end joining at telomere	IMP	biological process
GO:0031627	telomeric loop formation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0031860	telomeric 3' overhang formation	IEA	biological process
GO:0031848	protection from non-homologous end joining at telomere	IEA	biological process
GO:0031627	telomeric loop formation	IEA	biological process
GO:0008409	5'-3' exonuclease activity	IEA	molecular function
GO:0000784	nuclear chromosome, telomeric region	IDA	colocalizes with
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000781	chromosome, telomeric region	IDA	cellular component
GO:0016233	telomere capping	IMP	biological process
GO:0010833	telomere maintenance via telomere lengthening	IMP	biological process
GO:0036297	interstrand cross-link repair	IMP	biological process
GO:0031848	protection from non-homologous end joining at telomere	IMP	biological process
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)