• Gene id: 64853

Gene Summary

• Gene Symbol: AIDA   Gene   UCSC   Ensembl
• Aliases: C1orf80
• Gene name: axin interactor, dorsalization associated
• Alternate names: axin interactor, dorsalization-associated protein, axin interaction partner and dorsalization antagonist,
• Gene location: 1q41 (222712894: 222668012)     Exons: 10     NC_000001.11
• OMIM: 612375

Protein Summary

• Protein general information: Q96BJ3  
  • Name: Axin interactor, dorsalization associated protein (Axin interaction partner and dorsalization antagonist)
  • Length: 306  
  • Mass: 35023
  • Tissue specificity: Widely expressed in adult tissues, with highest expression in the heart and skeletal muscle. {ECO
• Sequence:

  MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSA
  ALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPA
  RVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIE
  LQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLH
  QTLHKE

• Structural information:
  • Protein Domains: (157..30-)
    (/note="C2-Aida-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01259"-)
  • Interpro: IPR025939  IPR023421  IPR036818  IPR035892  
  • Prosite: PS51911
  • STRING: ENSP00000339161
• Other Databases: GeneCards:  AIDA  Malacards:  AIDA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007275	multicellular organism development	IEA	biological process
GO:0043508	negative regulation of JUN kinase activity	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031333	negative regulation of protein-containing complex assembly	IEA	biological process
GO:0043254	regulation of protein-containing complex assembly	IEA	biological process
GO:0043508	negative regulation of JUN kinase activity	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0046329	negative regulation of JNK cascade	IEA	biological process
GO:0046329	negative regulation of JNK cascade	ISS	biological process
GO:0009953	dorsal/ventral pattern formation	ISS	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0031333	negative regulation of protein-containing complex assembly	ISS	biological process
GO:0048264	determination of ventral identity	IBA	biological process
GO:0035091	phosphatidylinositol binding	IBA	molecular function
GO:0016020	membrane	IBA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881