• Gene id: 64852

Gene Summary

• Gene Symbol: TUT1   Gene   UCSC   Ensembl
• Aliases: PAPD2, RBM21, STARPAP, TENT1, TUTase, URLC6
• Gene name: terminal uridylyl transferase 1, U6 snRNA-specific
• Alternate names: speckle targeted PIP5K1A-regulated poly(A) polymerase, PAP-associated domain-containing 2, RNA uridylyltransferase, RNA-binding motif protein 21, RNA-binding protein 21, TUTase 6, U6 snRNA-specific terminal uridylyltransferase 1, U6-TUTase, nuclear speckle target,
• Gene location: 11q12.3 (62591522: 62575051)     Exons: 9     NC_000011.10
• Gene summary(Entrez): This gene encodes a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. The encoded enzyme specifically adds and removes nucleotides from the 3' end of small nuclear RNAs and select mRNAs and may
• OMIM: 610641

Protein Summary

• Protein general information: Q9H6E5  
  • Name: Speckle targeted PIP5K1A regulated poly(A) polymerase (Star PAP) (EC 2.7.7.19) (RNA binding motif protein 21) (RNA binding protein 21) (U6 snRNA specific terminal uridylyltransferase 1) (U6 TUTase) (EC 2.7.7.52)
  • Length: 874  
  • Mass: 93847
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MAAVDSDVESLPRGGFRCCLCHVTTANRPSLDAHLGGRKHRHLVELRAARKAQGLRSVFVSGFPRDVDSAQLSEY
  FLAFGPVASVVMDKDKGVFAIVEMGDVGAREAVLSQSQHSLGGHRLRVRPREQKEFQSPASKSPKGAAPDSHQLA
  KALAEAADVGAQMIKLVGLRELSEAERQLRSLVVALMQEVFTEFFPGCVVHPFGSSINSFDVHGCDLDLFLDLGD
  LEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDSQPPASPQDSEALDFETPSSSLAPQTPDSALASETLA
  SPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRP
  SGLHGDVSLSNRLALHNSRFLSLCSELDGRVRPLVYTLRCWAQGRGLSGSGPLLSNYALTLLVIYFLQTRDPPVL
  PTVSQLTQKAGEGEQVEVDGWDCSFPRDASRLEPSINVEPLSSLLAQFFSCVSCWDLRGSLLSLREGQALPVAGG
  LPSNLWEGLRLGPLNLQDPFDLSHNVAANVTSRVAGRLQNCCRAAANYCRSLQYQRRSSRGRDWGLLPLLQPSSP
  SSLLSATPIPLPLAPFTQLTAALVQVFREALGCHIEQATKRTRSEGGGTGESSQGGTSKRLKVDGQKNCCEEGKE
  EQQGCAGDGGEDRVEEMVIEVGEMVQDWAMQSPGQPGDLPLTTGKHGAPGEEGQPSHAALAERGPKGHEAAQEWS
  QGEAGKGASLPSSASWRCALWHRVWQGRRRARRRLQQQTKEGAGGGAGTRAGWLATEAQVTQELKGLSGGEERPE
  TEPLLSFVASVSPADRMLTVTPLQDPQGLFPDLHHFLQVFLPQAIRHLK

• Structural information:
  • Protein Domains: (56..12-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (491..54-)
    (/note="PAP-associated-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR012677  IPR002058  IPR035979  IPR000504  IPR034389   IPR034388  IPR036236  
  • Prosite: PS50102
  • CDD: cd12279
  • PDB: 2E5G 5WU1 5WU2 5WU3 5WU4 5WU5 5WU6
  • PDBsum: 2E5G 5WU1 5WU2 5WU3 5WU4 5WU5 5WU6
  • DIP: 53651
  • STRING: ENSP00000308000
• Other Databases: GeneCards:  TUT1  Malacards:  TUT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016779	nucleotidyltransferase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0004652	polynucleotide adenylyltransferase activity	IBA	molecular function
GO:0006397	mRNA processing	IBA	biological process
GO:0006378	mRNA polyadenylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0050265	RNA uridylyltransferase activity	IDA	molecular function
GO:0050265	RNA uridylyltransferase activity	IDA	molecular function
GO:0016607	nuclear speck	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0098789	pre-mRNA cleavage required for polyadenylation	IDA	biological process
GO:0006378	mRNA polyadenylation	IDA	biological process
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IDA	colocalizes with
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IDA	colocalizes with
GO:0004652	polynucleotide adenylyltransferase activity	IDA	molecular function
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0016180	snRNA processing	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0006378	mRNA polyadenylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006378	mRNA polyadenylation	IEA	biological process
GO:0050265	RNA uridylyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0050265	RNA uridylyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0017070	U6 snRNA binding	IDA	molecular function
GO:0034477	U6 snRNA 3'-end processing	IDA	biological process
GO:0050265	RNA uridylyltransferase activity	IDA	molecular function
GO:0004652	polynucleotide adenylyltransferase activity	IDA	molecular function
GO:0071044	histone mRNA catabolic process	IMP	NOT|biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)