• Gene id: 64849

Gene Summary

• Gene Symbol: SLC13A3   Gene   UCSC   Ensembl
• Aliases: NADC3, SDCT2
• Gene name: solute carrier family 13 member 3
• Alternate names: solute carrier family 13 member 3, Na(+)/dicarboxylate cotransporter 3, hNaDC3, naDC-3, sodium-dependent high affinity dicarboxylate transporter 3,
• Gene location: 20q13.12 (46684484: 46557822)     Exons: 15     NC_000020.11
• Gene summary(Entrez): Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an impo
• OMIM: 606411

Protein Summary

• Protein general information: Q8WWT9  
  • Name: Solute carrier family 13 member 3 (Na(+)/dicarboxylate cotransporter 3) (NaDC 3) (hNaDC3) (Sodium dependent high affinity dicarboxylate transporter 2)
  • Length: 602  
  • Mass: 66,841
• Sequence:

  MAALAAAAKKVWSARRLLVLLFTPLALLPVVFALPPKEGRCLFVILLMAVYWCTEALPLSVTALLPIVLFPFMGI
  LPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLVGVQPARLILGMMVTTSFLSMWLSNTASTAM
  MLPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDE
  YRRNIWKGFLISIPYSASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLAGWLWISFL
  YGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMFAILLFTRDPKFIPGWASLFNPGF
  LSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSV
  WIGGQLHPLENVPPALAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLRVHPLYLMIPGTVGCSFAFMLPV
  STPPNSIAFASGHLLVKDMVRTGLLMNLMGVLLLSLAMNTWAQTIFQLGTFPDWADMYSVNVTALPPTLANDTFR
  TL

• Structural information:
  • Interpro: IPR001898  
  • STRING: ENSP00000279027
• Other Databases: GeneCards:  SLC13A3  Malacards:  SLC13A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006814	sodium ion transport	IEA	biological process
GO:0015137	citrate transmembrane transporter activity	IBA	molecular function
GO:0015141	succinate transmembrane transporter activity	IBA	molecular function
GO:0015183	L-aspartate transmembrane transporter activity	IEA	molecular function
GO:0015362	high-affinity sodium:dicarboxylate symporter activity	TAS	molecular function
GO:0015746	citrate transport	IBA	biological process
GO:0017153	sodium:dicarboxylate symporter activity	IBA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071422	succinate transmembrane transport	IEA	biological process
GO:0089712	L-aspartate transmembrane transport	IEA	biological process
GO:0005215	transporter activity	IEA	molecular function
GO:0005310	dicarboxylic acid transmembrane transporter activity	IEA	molecular function
GO:0005343	organic acid:sodium symporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006810	transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0006835	dicarboxylic acid transport	IEA	biological process
GO:0015137	citrate transmembrane transporter activity	IEA	molecular function
GO:0015137	citrate transmembrane transporter activity	IBA	molecular function
GO:0015141	succinate transmembrane transporter activity	IEA	molecular function
GO:0015141	succinate transmembrane transporter activity	IBA	molecular function
GO:0015183	L-aspartate transmembrane transporter activity	IEA	molecular function
GO:0015293	symporter activity	IEA	molecular function
GO:0015362	high-affinity sodium:dicarboxylate symporter activity	IEA	molecular function
GO:0015362	high-affinity sodium:dicarboxylate symporter activity	TAS	molecular function
GO:0015744	succinate transport	IEA	biological process
GO:0015746	citrate transport	IEA	biological process
GO:0015746	citrate transport	IBA	biological process
GO:0015810	aspartate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0017153	sodium:dicarboxylate symporter activity	IEA	molecular function
GO:0017153	sodium:dicarboxylate symporter activity	IBA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071422	succinate transmembrane transport	IEA	biological process
GO:0089712	L-aspartate transmembrane transport	IEA	biological process
GO:1903825	organic acid transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0015137	citrate transmembrane transporter activity	IBA	molecular function
GO:0015141	succinate transmembrane transporter activity	IBA	molecular function
GO:0015362	high-affinity sodium:dicarboxylate symporter activity	TAS	molecular function
GO:0015746	citrate transport	IBA	biological process
GO:0017153	sodium:dicarboxylate symporter activity	IBA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Diabetes	GAD: 18602983
Azoospermia	MIK: 17928628
Azoospermia	MIK: 17928628
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17928628	Azoospermia				Male infertility	CRISP1 SPINLW1 FAM12B DEFB129 CFTR AQP5 KCNK4 KCNK17 SLC6A20 SLC13A3 DEFB126 and DEFB106A
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq