• Gene id: 64844

Gene Summary

• Gene Symbol: MARCHF7   Gene   UCSC   Ensembl
• Aliases: AXO, AXOT, MARCH-VII, MARCH7, RNF177
• Gene name: membrane associated ring-CH-type finger 7
• Alternate names: E3 ubiquitin-protein ligase MARCHF7, E3 ubiquitin-protein ligase MARCH7, RING finger protein 177, RING-type E3 ubiquitin transferase MARCH7, RING-type E3 ubiquitin transferase MARCHF7, axotrophin, membrane associated ring finger 7, membrane-associated RING finge,
• Gene location: 2q24.2 (159712493: 159771026)     Exons: 16     NC_000002.12
• Gene summary(Entrez): MARCH7 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH proteins add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments (
• OMIM: 613334

Protein Summary

• Protein general information: Q9H992  
  • Name: E3 ubiquitin protein ligase MARCHF7 (EC 2.3.2.27) (Axotrophin) (Membrane associated RING finger protein 7) (Membrane associated RING CH protein VII) (MARCH VII) (RING finger protein 177) (RING type E3 ubiquitin transferase MARCHF7)
  • Length: 704  
  • Mass: 78051
• Sequence:

  MESKPSRIPRRISVQPSSSLSARMMSGSRGSSLNDTYHSRDSSFRLDSEYQSTSASASASPFQSAWYSESEITQG
  ARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFGTDLMRERRDLERRT
  DSSISNLMDYSHRSGDFTTSSYVQDRVPSYSQGARPKENSMSTLQLNTSSTNHQLPSEHQTILSSRDSRNSLRSN
  FSSRESESSRSNTQPGFSYSSSRDEAPIISNSERVVSSQRPFQESSDNEGRRTTRRLLSRIASSMSSTFFSRRSS
  QDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVPDNRASEASQGFRFLRRRWGLSSLSHNHSSESDSENFNQ
  ESEGRNTGPWLSSSLRNRCTPLFSRRRREGRDESSRIPTSDTSSRSHIFRRESNEVVHLEAQNDPLGAAANRPQA
  SAASSSATTGGSTSDSAQGGRNTGISGILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAP
  SRDPERLQKIKESLLLEDSEEEEGDLCRICQMAAASSSNLLIEPCKCTGSLQYVHQDCMKKWLQAKINSGSSLEA
  VTTCELCKEKLELNLEDFDIHELHRAHANEQAEYEFISSGLYLVVLLHLCEQSFSDMMGNTNEPSTRVRFINLAR
  TLQAHMEDLETSEDDSEEDGDHNRTFDIA

• Structural information:
  • Interpro: IPR011016  IPR013083  
  • Prosite: PS51292
  • STRING: ENSP00000259050
• Other Databases: GeneCards:  MARCHF7  Malacards:  MARCHF7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006513	protein monoubiquitination	IDA	biological process
GO:0051865	protein autoubiquitination	IBA	biological process
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0031624	ubiquitin conjugating enzyme binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002643	regulation of tolerance induction	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0043130	ubiquitin binding	IEA	molecular function
GO:0051865	protein autoubiquitination	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0031624	ubiquitin conjugating enzyme binding	IPI	molecular function
GO:0031624	ubiquitin conjugating enzyme binding	IPI	molecular function
GO:1905524	negative regulation of protein autoubiquitination	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:1901799	negative regulation of proteasomal protein catabolic process	IMP	biological process
GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:1902916	positive regulation of protein polyubiquitination	IMP	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0097371	MDM2/MDM4 family protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0043130	ubiquitin binding	ISS	molecular function
GO:0051865	protein autoubiquitination	ISS	biological process
GO:1902166	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	biological process
GO:0005886	plasma membrane	ISS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray