• Gene id: 6484

Gene Summary

• Gene Symbol: ST3GAL4   Gene   UCSC   Ensembl
• Aliases: CGS23, NANTA3, SAT3, SIAT4, SIAT4C, ST-4, ST3GalA.2, ST3GalIV, STZ, gal-NAc6S
• Gene name: ST3 beta-galactoside alpha-2,3-sialyltransferase 4
• Alternate names: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4, alpha 2,3-ST 4, alpha 2,3-sialyltransferase IV, alpha-3-N-acetylneuraminyltransferase, beta-galactoside alpha-2,3-sialyltransferase 4, gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase, sia,
• Gene location: 11q24.2 (126355685: 126414640)     Exons: 17     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be invol
• OMIM: 613898

Protein Summary

• Protein general information: Q11206  
  • Name: CMP N acetylneuraminate beta galactosamide alpha 2,3 sialyltransferase 4 (Alpha 2,3 ST 4) (Beta galactoside alpha 2,3 sialyltransferase 4) (EC 2.4.99.2) (EC 2.4.99.4) (Alpha 2,3 sialyltransferase IV) (Gal NAc6S) (Gal beta 1,4 GalNAc alpha 2,3 sialyltransf
  • Length: 333  
  • Mass: 38045
  • Tissue specificity: Highly expressed in adult placenta, ovary and testes.
• Sequence:

  MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDY
  FWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNA
  PVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVN
  PKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQIT
  LKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • STRING: ENSP00000436047
• Other Databases: GeneCards:  ST3GAL4  Malacards:  ST3GAL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IBA	molecular function
GO:0008373	sialyltransferase activity	IBA	molecular function
GO:0006486	protein glycosylation	IBA	biological process
GO:0009247	glycolipid biosynthetic process	IBA	biological process
GO:0047288	monosialoganglioside sialyltransferase activity	IBA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	TAS	molecular function
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IEA	molecular function
GO:0047288	monosialoganglioside sialyltransferase activity	IEA	molecular function
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0016266	O-glycan processing	TAS	biological process
GO:0018146	keratan sulfate biosynthetic process	TAS	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0047288	monosialoganglioside sialyltransferase activity	IEA	molecular function
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IEA	molecular function
GO:0047288	monosialoganglioside sialyltransferase activity	IDA	molecular function
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IDA	molecular function
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IDA	molecular function
GO:0030259	lipid glycosylation	IDA	biological process
GO:0009247	glycolipid biosynthetic process	IDA	biological process
GO:0009101	glycoprotein biosynthetic process	IDA	biological process
GO:0006486	protein glycosylation	IDA	biological process
GO:1990743	protein sialylation	IDA	biological process
GO:0097503	sialylation	IDA	biological process
GO:0097503	sialylation	IDA	biological process
GO:0009312	oligosaccharide biosynthetic process	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0050890	cognition	IMP	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00601	Glycosphingolipid biosynthesis - lacto and neolacto series

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq