• Gene id: 64838

Gene Summary

• Gene Symbol: FNDC4   Gene   UCSC   Ensembl
• Aliases: FRCP1
• Gene name: fibronectin type III domain containing 4
• Alternate names: fibronectin type III domain-containing protein 4, fibronectin type III repeat-containing protein 1,
• Gene location: 2p23.3 (27495501: 27491882)     Exons: 7     NC_000002.12
• OMIM: 611905

Protein Summary

• Protein general information: Q9H6D8  
  • Name: Fibronectin type III domain containing protein 4 (Fibronectin type III repeat containing protein 1)
  • Length: 234  
  • Mass: 25159
  • Tissue specificity: Up-regulated in colon cells of patients with inflammatory bowel disease (IBD). {ECO
• Sequence:

  MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIV
  IGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSS
  PGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKK
  SPSINTIDV

• Structural information:
  • Protein Domains: (47..14-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR013783  
  • Prosite: PS50853
  • CDD: cd00063
  • STRING: ENSP00000264703
• Other Databases: GeneCards:  FNDC4  Malacards:  FNDC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IBA	cellular component
GO:0050728	negative regulation of inflammatory response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005615	extracellular space	ISS	cellular component
GO:0071559	response to transforming growth factor beta	IEP	biological process
GO:0050728	negative regulation of inflammatory response	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray