• Gene id: 6483

Gene Summary

• Gene Symbol: ST3GAL2   Gene   UCSC   Ensembl
• Aliases: Gal-NAc6S, SIAT4B, ST3GALII, ST3GalA.2
• Gene name: ST3 beta-galactoside alpha-2,3-sialyltransferase 2
• Alternate names: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2, Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase, SIAT4-B, ST3Gal II, alpha 2,3-ST 2, beta-galactoside alpha-2,3-sialyltransferase 2, sialyltransferase 4B (beta-galactosidase alpha-2,3-sia,
• Gene location: 16q22.1 (70439099: 70375976)     Exons: 7     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a
• OMIM: 614045

Protein Summary

• Protein general information: Q16842  
  • Name: CMP N acetylneuraminate beta galactosamide alpha 2,3 sialyltransferase 2 (Alpha 2,3 ST 2) (Beta galactoside alpha 2,3 sialyltransferase 2) (EC 2.4.99.4) (Gal NAc6S) (Gal beta 1,3 GalNAc alpha 2,3 sialyltransferase) (ST3Gal II) (ST3GalII) (ST3GalA.2) (Sial
  • Length: 350  
  • Mass: 40173
  • Tissue specificity: Highly expressed in skeletal muscle and heart and to a much lesser extent in brain, placenta, liver and pancreas. Scarcely detectable in lung and kidney. {ECO
• Sequence:

  MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRC
  MGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCR
  RCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLL
  WIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFG
  ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • STRING: ENSP00000377257
• Other Databases: GeneCards:  ST3GAL2  Malacards:  ST3GAL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IBA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0016266	O-glycan processing	TAS	biological process
GO:0018146	keratan sulfate biosynthetic process	TAS	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IEA	molecular function
GO:0047288	monosialoganglioside sialyltransferase activity	IDA	molecular function
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IDA	molecular function
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IDA	molecular function
GO:0009247	glycolipid biosynthetic process	IDA	biological process
GO:0030259	lipid glycosylation	IDA	biological process
GO:0006486	protein glycosylation	IDA	biological process
GO:0009101	glycoprotein biosynthetic process	IDA	biological process
GO:0009312	oligosaccharide biosynthetic process	IDA	biological process
GO:0097503	sialylation	IDA	biological process
GO:1990743	protein sialylation	IDA	biological process
GO:0097503	sialylation	IDA	biological process
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00512	Mucin type O-glycan biosynthesis
hsa00603	Glycosphingolipid biosynthesis - globo and isoglobo series
hsa00533	Glycosaminoglycan biosynthesis - keratan sulfate
hsa00604	Glycosphingolipid biosynthesis - ganglio series

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq