• Gene id: 6482

Gene Summary

• Gene Symbol: ST3GAL1   Gene   UCSC   Ensembl
• Aliases: Gal-NAc6S, SIAT4A, SIATFL, ST3GalA, ST3GalA.1, ST3GalIA, ST3GalIA,1, ST3O
• Gene name: ST3 beta-galactoside alpha-2,3-sialyltransferase 1
• Alternate names: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1, Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase, SIAT4-A, ST3GalI, alpha 2,3-ST 1, beta-galactoside alpha-2,3-sialyltransferase 1, sialyltransferase 4A (beta-galactosidase alpha-2,3-sialy,
• Gene location: 8q24.22 (133572533: 133454847)     Exons: 11     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a
• OMIM: 601422

Protein Summary

• Protein general information: Q11201  
  • Name: CMP N acetylneuraminate beta galactosamide alpha 2,3 sialyltransferase 1 (Alpha 2,3 ST 1) (Beta galactoside alpha 2,3 sialyltransferase 1) (EC 2.4.99.4) (Gal NAc6S) (Gal beta 1,3 GalNAc alpha 2,3 sialyltransferase) (SIATFL) (ST3Gal I) (ST3GalI) (ST3GalA.1
  • Length: 340  
  • Mass: 39075
  • Tissue specificity: Expressed in several tissues. Highest expression in lung, liver, skeletal muscle, kidney, pancreas, spleen and placenta.
• Sequence:

  MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCTCTHCIGQRKLSAWFD
  ERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKELFRVVPGNVDPMLEKRSVGCRRCAVVGNSGN
  LRESSYGPEIDSHDFVLRMNKAPTAGFEADVGTKTTHHLVYPESFRELGDNVSMILVPFKTIDLEWVVSAITTGT
  ISHTYIPVPAKIRVKQDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHY
  WENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • STRING: ENSP00000428540
• Other Databases: GeneCards:  ST3GAL1  Malacards:  ST3GAL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IDA	molecular function
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IBA	molecular function
GO:0097503	sialylation	ISS	biological process
GO:0006487	protein N-linked glycosylation	ISS	biological process
GO:0006054	N-acetylneuraminate metabolic process	ISS	biological process
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	ISS	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	TAS	molecular function
GO:0006464	cellular protein modification process	TAS	biological process
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0016266	O-glycan processing	TAS	biological process
GO:0018146	keratan sulfate biosynthetic process	TAS	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0003836	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00512	Mucin type O-glycan biosynthesis
hsa00603	Glycosphingolipid biosynthesis - globo and isoglobo series
hsa00533	Glycosaminoglycan biosynthesis - keratan sulfate
hsa00604	Glycosphingolipid biosynthesis - ganglio series

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq