• Gene id: 64816

Gene Summary

• Gene Symbol: CYP3A43   Gene   UCSC   Ensembl
• Gene name: cytochrome P450 family 3 subfamily A member 43
• Alternate names: cytochrome P450 3A43, cytochrome P450, family 3, subfamily A, polypeptide 43, cytochrome P450, subfamily IIIA, polypeptide 43,
• Gene location: 7q22.1 (99827625: 99867137)     Exons: 15     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The encoded protei
• OMIM: 608130

Protein Summary

• Protein general information: Q9HB55  
  • Name: Cytochrome P450 3A43 (EC 1.14.14.1)
  • Length: 503  
  • Mass: 57670
  • Tissue specificity: Highest expression level in prostate. Also expressed in liver, kidney, pancreas, fetal liver and fetal skeletal muscle. {ECO
• Sequence:

  MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNFDRECNEKYGEMWGLY
  EGQQPMLVIMDPDMIKTVLVKECYSVFTNQMPLGPMGFLKSALSFAEDEEWKRIRTLLSPAFTSVKFKEMVPIIS
  QCGDMLVRSLRQEAENSKSINLKDFFGAYTMDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLLISL
  FPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSI
  IIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTR
  VCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDLYRYIPFGAGPRNCIGMRFALT
  NIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIVLKVHLRDGITSGP

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR008072  IPR002402  IPR036396  
  • Prosite: PS00086
  • STRING: ENSP00000222382
• Other Databases: GeneCards:  CYP3A43  Malacards:  CYP3A43

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008202	steroid metabolic process	IBA	biological process
GO:0008395	steroid hydroxylase activity	IBA	molecular function
GO:0050649	testosterone 6-beta-hydroxylase activity	IBA	molecular function
GO:0070989	oxidative demethylation	IBA	biological process
GO:0101020	estrogen 16-alpha-hydroxylase activity	IBA	molecular function
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005506	iron ion binding	IEA	molecular function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0070330	aromatase activity	IEA	molecular function
GO:0004497	monooxygenase activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0004497	monooxygenase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05204	Chemical carcinogenesis

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R