• Gene id: 64806

Gene Summary

• Gene Symbol: IL25   Gene   UCSC   Ensembl
• Aliases: IL17E
• Gene name: interleukin 25
• Alternate names: interleukin-25, interleukin-17E,
• Gene location: 14q11.2 (23372808: 23376402)     Exons: 16     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cy
• OMIM: 605658

Protein Summary

• Protein general information: Q9H293  
  • Name: Interleukin 25 (IL 25) (Interleukin 17E) (IL 17E)
  • Length: 177  
  • Mass: 20330
  • Tissue specificity: Expressed at low levels in several tissues, including brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea.
• Sequence:

  MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCR
  ASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKG
  THKGYCLERRLYRVSLACVCVRPRVMG

• Structural information:
  • Interpro: IPR029034  IPR010345  
  • STRING: ENSP00000328111
• Other Databases: GeneCards:  IL25  Malacards:  IL25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0097400	interleukin-17-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0002437	inflammatory response to antigenic stimulus	IEA	biological process
GO:0032616	interleukin-13 production	IEA	biological process
GO:0009624	response to nematode	IEA	biological process
GO:0009620	response to fungus	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0032634	interleukin-5 production	IEA	biological process
GO:0030222	eosinophil differentiation	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030380	interleukin-17E receptor binding	TAS	molecular function
GO:0008150	biological_process	ND	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04657	IL-17 signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)