• Gene id: 6480

Gene Summary

• Gene Symbol: ST6GAL1   Gene   UCSC   Ensembl
• Aliases: SIAT1, ST6GalI, ST6N
• Gene name: ST6 beta-galactoside alpha-2,6-sialyltransferase 1
• Alternate names: beta-galactoside alpha-2,6-sialyltransferase 1, B-cell antigen CD75, CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1, ST6 N-acetylgalactosaminide alpha-2,6-sialyl,
• Gene location: 3q27.3 (136289850: 136256626)     Exons: 16     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the
• OMIM: 109675

Protein Summary

• Protein general information: P15907  
  • Name: Beta galactoside alpha 2,6 sialyltransferase 1 (Alpha 2,6 ST 1) (EC 2.4.99.1) (B cell antigen CD75) (CMP N acetylneuraminate beta galactosamide alpha 2,6 sialyltransferase 1) (ST6Gal I) (ST6GalI) (Sialyltransferase 1)
  • Length: 406  
  • Mass: 46605
• Sequence:

  MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGR
  QTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNV
  SMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGT
  KTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQM
  PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYE
  KNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • PDB: 4JS1 4JS2
  • PDBsum: 4JS1 4JS2
  • STRING: ENSP00000169298
• Other Databases: GeneCards:  ST6GAL1  Malacards:  ST6GAL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003835	beta-galactoside alpha-2,6-sialyltransferase activity	IBA	molecular function
GO:0003835	beta-galactoside alpha-2,6-sialyltransferase activity	IDA	molecular function
GO:0097503	sialylation	IDA	biological process
GO:0018279	protein N-linked glycosylation via asparagine	IDA	biological process
GO:0008373	sialyltransferase activity	IDA	molecular function
GO:0006054	N-acetylneuraminate metabolic process	IDA	biological process
GO:0000139	Golgi membrane	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006959	humoral immune response	TAS	biological process
GO:0003835	beta-galactoside alpha-2,6-sialyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0003835	beta-galactoside alpha-2,6-sialyltransferase activity	TAS	molecular function
GO:0003835	beta-galactoside alpha-2,6-sialyltransferase activity	TAS	molecular function
GO:0003835	beta-galactoside alpha-2,6-sialyltransferase activity	TAS	molecular function
GO:0016266	O-glycan processing	TAS	biological process
GO:0003835	beta-galactoside alpha-2,6-sialyltransferase activity	IEA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	IEA	biological process
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis
hsa00514	Other types of O-glycan biosynthesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray