• Gene id: 64792

Gene Summary

• Gene Symbol: IFT22   Gene   UCSC   Ensembl
• Aliases: FAP9, RABL5
• Gene name: intraflagellar transport 22
• Alternate names: intraflagellar transport protein 22 homolog, RAB, member RAS oncogene family-like 5, RAB, member of RAS oncogene family-like 5, intraflagellar transport 22 homolog, rab-like protein 5,
• Gene location: 7q22.1 (101321822: 101310913)     Exons: 6     NC_000007.14

Protein Summary

• Protein general information: Q9H7X7  
  • Name: Intraflagellar transport protein 22 homolog (Rab like protein 5)
  • Length: 185  
  • Mass: 20835
• Sequence:

  MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWP
  ALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNL
  EDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT

• Structural information:
  • Interpro: IPR027417  
  • STRING: ENSP00000320359
• Other Databases: GeneCards:  IFT22  Malacards:  IFT22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0006886	intracellular protein transport	IBA	biological process
GO:0030992	intraciliary transport particle B	ISS	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005929	cilium	IEA	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0035735	intraciliary transport involved in cilium assembly	TAS	biological process
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0030992	intraciliary transport particle B	IEA	cellular component
GO:0005929	cilium	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray