• Gene id: 64789

Gene Summary

• Gene Symbol: EXO5   Gene   UCSC   Ensembl
• Aliases: C1orf176, DEM1, Exo V, hExo5
• Gene name: exonuclease 5
• Alternate names: exonuclease V, defects in morphology 1 homolog, defects in morphology protein 1 homolog, probable exonuclease V,
• Gene location: 1p34.2 (47463729: 47450786)     Exons: 5     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a single-stranded DNA (ssDNA)-specific exonuclease that can slide along the DNA before cutting it. However, human replication protein A binds ssDNA and restricts sliding of the encoded protein, providing a 5'-directiona
• OMIM: 618601

Protein Summary

• Protein general information: Q9H790  
  • Name: Exonuclease V (Exo V) (hExo5) (EC 3.1. . ) (Defects in morphology protein 1 homolog)
  • Length: 373  
  • Mass: 41816
• Sequence:

  MAETREEETVSAEASGFSDLSDSEFLEFLDLEDAQESKALVNMPGPSSESLGKDDKPISLQNWKRGLDILSPMER
  FHLKYLYVTDLATQNWCELQTAYGKELPGFLAPEKAAVLDTGASIHLARELELHDLVTVPVTTKEDAWAIKFLNI
  LLLIPTLQSEGHIREFPVFGEGEGVLLVGVIDELHYTAKGELELAELKTRRRPMLPLEAQKKKDCFQVSLYKYIF
  DAMVQGKVTPASLIHHTKLCLEKPLGPSVLRHAQQGGFSVKSLGDLMELVFLSLTLSDLPVIDILKIEYIHQETA
  TVLGTEIVAFKEKEVRAKVQHYMAYWMGHREPQGVDVEEAWKCRTCTYADICEWRKGSGVLSSTLAPQVKKAK

• Structural information:
  • Interpro: IPR019190  
  • STRING: ENSP00000361788
• Other Databases: GeneCards:  EXO5  Malacards:  EXO5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036297	interstrand cross-link repair	IBA	biological process
GO:0045145	single-stranded DNA 5'-3' exodeoxyribonuclease activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0051539	4 iron, 4 sulfur cluster binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0045145	single-stranded DNA 5'-3' exodeoxyribonuclease activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0036297	interstrand cross-link repair	IMP	biological process
GO:0008310	single-stranded DNA 3'-5' exodeoxyribonuclease activity	TAS	molecular function
GO:0045145	single-stranded DNA 5'-3' exodeoxyribonuclease activity	IEA	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0004518	nuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)