• Gene id: 64785

Gene Summary

• Gene Symbol: GINS3   Gene   UCSC   Ensembl
• Aliases: PSF3
• Gene name: GINS complex subunit 3
• Alternate names: DNA replication complex GINS protein PSF3, GINS complex subunit 3 (Psf3 homolog),
• Gene location: 16q21 (58392470: 58406146)     Exons: 4     NC_000016.10
• Gene summary(Entrez): This gene encodes a protein subunit of the GINS heterotetrameric complex, which is essential for the initiation of DNA replication and replisome progression in eukaryotes. Alternatively spliced transcript variants encoding distinct isoforms have been desc
• OMIM: 610610

Protein Summary

• Protein general information: Q9BRX5  
  • Name: DNA replication complex GINS protein PSF3 (GINS complex subunit 3)
  • Length: 216  
  • Mass: 24535
• Sequence:

  MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKG
  LFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIM
  DSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED

• Structural information:
  • Interpro: IPR021151  IPR036224  IPR010492  IPR038437  
  • PDB: 2E9X 2EHO 2Q9Q
  • PDBsum: 2E9X 2EHO 2Q9Q
  • DIP: 29333
• Other Databases: GeneCards:  GINS3  Malacards:  GINS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006260	DNA replication	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006271	DNA strand elongation involved in DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)