• Gene id: 64784

Gene Summary

• Gene Symbol: CRTC3   Gene   UCSC   Ensembl
• Aliases: TORC-3, TORC3
• Gene name: CREB regulated transcription coactivator 3
• Alternate names: CREB-regulated transcription coactivator 3, transducer of regulated CREB protein 3, transducer of regulated cAMP response element-binding protein (CREB) 3,
• Gene location: 15q26.1 (105241742: 105243466)     Exons: 1     NC_000002.12
• Gene summary(Entrez): This gene is a member of the CREB regulated transcription coactivator gene family. This family regulates CREB-dependent gene transcription in a phosphorylation-independent manner and may be selective for cAMP-responsive genes. The protein encoded by this
• OMIM: 608986

Protein Summary

• Protein general information: Q6UUV7  
  • Name: CREB regulated transcription coactivator 3 (Transducer of regulated cAMP response element binding protein 3) (TORC 3) (Transducer of CREB protein 3)
  • Length: 619  
  • Mass: 66959
  • Tissue specificity: Predominantly expressed in B and T lymphocytes. Highest levels in lung. Also expressed in brain, colon, heart, kidney, ovary, and prostate. Weak expression in liver, pancreas, muscle, small intestine, spleen and stomach. {ECO
• Sequence:

  MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLRSSASE
  FQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPG
  FRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLP
  KQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSM
  SVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASALHPSLRLFSLSNPSLS
  TTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPTSQMVSSDRSQLSFLPTEAQAQVSPPPPYPA
  PQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSR
  ELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSD
  SSMGLLDPSVEETFRADRL

• Structural information:
  • Interpro: IPR024786  IPR024785  IPR024784  IPR024783  
  • DIP: 59211
  • STRING: ENSP00000268184
• Other Databases: GeneCards:  CRTC3  Malacards:  CRTC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042116	macrophage activation	IMP	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008140	cAMP response element binding protein binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0032793	positive regulation of CREB transcription factor activity	IBA	biological process
GO:0032793	positive regulation of CREB transcription factor activity	IEA	biological process
GO:0051289	protein homotetramerization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008140	cAMP response element binding protein binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0050995	negative regulation of lipid catabolic process	IEA	biological process
GO:0032793	positive regulation of CREB transcription factor activity	IEA	biological process
GO:0097009	energy homeostasis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq