• Gene id: 64781

Gene Summary

• Gene Symbol: CERK   Gene   UCSC   Ensembl
• Aliases: LK4, dA59H18.2, dA59H18.3, hCERK
• Gene name: ceramide kinase
• Alternate names: ceramide kinase, acylsphingosine kinase, lipid kinase 4, lipid kinase LK4,
• Gene location: 22q13.31 (46738251: 46684409)     Exons: 14     NC_000022.11
• Gene summary(Entrez): CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation (Kim et al., 2006 [PubMed 16488390]).
• OMIM: 610307

Protein Summary

• Protein general information: Q8TCT0  
  • Name: Ceramide kinase (hCERK) (EC 2.7.1.138) (Acylsphingosine kinase) (Lipid kinase 4) (LK4)
  • Length: 537  
  • Mass: 59977
  • Tissue specificity: High level expression in heart, brain, skeletal muscle, kidney and liver; moderate in peripheral blood leukocytes and thymus; very low in spleen, small intestine, placenta and lung. {ECO
• Sequence:

  MGATGAAEPLQSVLWVKQQRCAVSLEPARALLRWWRSPGPGAGAPGADACSVPVSEIIAVEETDVHGKHQGSGKW
  QKMEKPYAFTVHCVKRARRHRWKWAQVTFWCPEEQLCHLWLQTLREMLEKLTSRPKHLLVFINPFGGKGQGKRIY
  ERKVAPLFTLASITTDIIVTEHANQAKETLYEINIDKYDGIVCVGGDGMFSEVLHGLIGRTQRSAGVDQNHPRAV
  LVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDS
  EKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTVGSPRDRKPCRAGCFVCRQSKQQLEEEQKKALYGLEAA
  EDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQQDQFDFTFV
  EVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFAR
  GIEENPKPDSHS

• Structural information:
  • Protein Domains: (128..27-)
    (/note="DAGKc-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00783"-)
  • Interpro: IPR017438  IPR001206  IPR016064  
  • Prosite: PS50146
  • STRING: ENSP00000216264
• Other Databases: GeneCards:  CERK  Malacards:  CERK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001729	ceramide kinase activity	IBA	molecular function
GO:0006672	ceramide metabolic process	IBA	biological process
GO:0016310	phosphorylation	IBA	biological process
GO:0001727	lipid kinase activity	IBA	molecular function
GO:0006665	sphingolipid metabolic process	IBA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0001729	ceramide kinase activity	IDA	molecular function
GO:0003951	NAD+ kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0001729	ceramide kinase activity	IEA	molecular function
GO:0102773	dihydroceramide kinase activity	IEA	molecular function
GO:0001729	ceramide kinase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0006687	glycosphingolipid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001729	ceramide kinase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0046834	lipid phosphorylation	IEA	biological process
GO:0046834	lipid phosphorylation	IEA	biological process
GO:0046834	lipid phosphorylation	IEA	biological process
GO:0046834	lipid phosphorylation	IEA	biological process
GO:0046834	lipid phosphorylation	IEA	biological process
GO:0046834	lipid phosphorylation	IEA	biological process
GO:0046834	lipid phosphorylation	IEA	biological process
GO:0046834	lipid phosphorylation	IEA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0001729	ceramide kinase activity	IDA	molecular function
GO:0001729	ceramide kinase activity	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0006672	ceramide metabolic process	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa00600	Sphingolipid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq