• Gene id: 64771

Gene Summary

• Gene Symbol: ILRUN   Gene   UCSC   Ensembl
• Aliases: C6orf106, FP852, dJ391O22.4
• Gene name: inflammation and lipid regulator with UBA-like and NBR1-like domains
• Alternate names: protein ILRUN, inflammation and lipid regulator with UBA-like and NBR1-like domains protein, uncharacterized protein C6orf106,
• Gene location: 6p21.31 (34696766: 34587287)     Exons: 7     NC_000006.12
• OMIM: 612217

Protein Summary

• Protein general information: Q9H6K1  
  • Name: Protein ILRUN (Inflammation and lipid regulator with UBA like and NBR1 like domains protein)
  • Length: 298  
  • Mass: 32872
  • Tissue specificity: Expressed in lung (at protein level). {ECO
• Sequence:

  MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNISVPSM
  SFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPS
  RAGMYQGQWRMCTATGLYYGDVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDEN
  NLKDPGGSEFDSISKNTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYPFGQS

• Structural information:
  • Interpro: IPR039517  IPR013783  IPR032350  IPR009060  
  • CDD: cd14947 cd14349
  • STRING: ENSP00000363135
• Other Databases: GeneCards:  ILRUN  Malacards:  ILRUN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000407	phagophore assembly site	IBA	cellular component
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0016236	macroautophagy	IBA	biological process
GO:0043392	negative regulation of DNA binding	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1900181	negative regulation of protein localization to nucleus	IMP	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IMP	biological process
GO:0050687	negative regulation of defense response to virus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032480	negative regulation of type I interferon production	IMP	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R