Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 6477
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol SIAH1   Gene   UCSC   Ensembl
Aliases SIAH1A
Gene name siah E3 ubiquitin protein ligase 1
Alternate names E3 ubiquitin-protein ligase SIAH1, RING-type E3 ubiquitin transferase SIAH1, seven in absentia homolog 1, siah-1a,
Gene location 16q12.1 (48448434: 48354580)     Exons: 9     NC_000016.10
Gene summary(Entrez) This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has
OMIM 602212

Protein Summary
Protein general information Q8IUQ4  

Name: E3 ubiquitin protein ligase SIAH1 (EC 2.3.2.27) (RING type E3 ubiquitin transferase SIAH1) (Seven in absentia homolog 1) (Siah 1) (Siah 1a)

Length: 282  Mass: 31123

Tissue specificity: Widely expressed at a low level. Down-regulated in advanced hepatocellular carcinomas. {ECO

Sequence MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTC
RGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMH
QHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRL
ELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Structural information
Interpro:  IPR018121  IPR004162  IPR008974  IPR001841  IPR013083  
IPR013010  
Prosite:   PS50089 PS51081

PDB:  		 2A25 4C9Z 4CA1 4I7B 4I7C 4I7D 4X3G 5WZZ
PDBsum:   2A25 4C9Z 4CA1 4I7B 4I7C 4I7D 4X3G 5WZZ

DIP:  
35684
MINT:  
STRING:   ENSP00000349156
Other Databases GeneCards:  SIAH1  Malacards:  SIAH1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0061630 ubiquitin protein ligase
activity
 IBA molecular function
GO:0006511 ubiquitin-dependent prote
in catabolic process
 IBA biological process
GO:0043161 proteasome-mediated ubiqu
itin-dependent protein ca
tabolic process
 IBA biological process
GO:0031624 ubiquitin conjugating enz
yme binding
 IBA molecular function
GO:0005737 cytoplasm
 IBA cellular component
GO:0008270 zinc ion binding
 IDA molecular function
GO:0030877 beta-catenin destruction
complex
 IDA cellular component
GO:0051402 neuron apoptotic process
 ISS biological process
GO:0006511 ubiquitin-dependent prote
in catabolic process
 ISS biological process
GO:0008270 zinc ion binding
 ISS molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 ISS molecular function
GO:0043161 proteasome-mediated ubiqu
itin-dependent protein ca
tabolic process
 ISS biological process
GO:0005634 nucleus
 ISS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0006511 ubiquitin-dependent prote
in catabolic process
 IEA biological process
GO:0008270 zinc ion binding
 IEA molecular function
GO:0042025 host cell nucleus
 IEA cellular component
GO:0007275 multicellular organism de
velopment
 IEA biological process
GO:0046872 metal ion binding
 IEA molecular function
GO:0007283 spermatogenesis
 IEA biological process
GO:0016740 transferase activity
 IEA molecular function
GO:0030154 cell differentiation
 IEA biological process
GO:0007049 cell cycle
 IEA biological process
GO:0007275 multicellular organism de
velopment
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0006915 apoptotic process
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 TAS cellular component
GO:0006915 apoptotic process
 TAS biological process
GO:0007399 nervous system developmen
t
 TAS biological process
GO:0007411 axon guidance
 TAS biological process
GO:0009653 anatomical structure morp
hogenesis
 TAS biological process
GO:0061630 ubiquitin protein ligase
activity
 IDA molecular function
GO:0006511 ubiquitin-dependent prote
in catabolic process
 IDA biological process
GO:0000209 protein polyubiquitinatio
n
 TAS biological process
GO:0044267 cellular protein metaboli
c process
 TAS biological process
GO:1902842 negative regulation of ne
trin-activated signaling
pathway
 TAS biological process
GO:0004842 ubiquitin-protein transfe
rase activity
 TAS molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 TAS molecular function
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005886 plasma membrane
 IEA cellular component
GO:0005769 early endosome
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0051402 neuron apoptotic process
 IEA biological process
GO:0031648 protein destabilization
 IEA biological process
GO:0008022 protein C-terminus bindin
g
 IEA molecular function
GO:0006511 ubiquitin-dependent prote
in catabolic process
 IEA biological process
GO:0005829 cytosol
 IEA cellular component
GO:0004842 ubiquitin-protein transfe
rase activity
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0016567 protein ubiquitination
 IEA biological process
GO:0043065 positive regulation of ap
optotic process
 IDA biological process
GO:0030163 protein catabolic process
 IDA biological process
GO:0008270 zinc ion binding
 IDA molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 IMP molecular function
GO:2001244 positive regulation of in
trinsic apoptotic signali
ng pathway
 IMP biological process
GO:0008022 protein C-terminus bindin
g
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04310Wnt signaling pathway
hsa04120Ubiquitin mediated proteolysis
hsa04115p53 signaling pathway

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Associated with spermatogenesis and epigenetic regulation MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract