• Gene id: 64769

Gene Summary

• Gene Symbol: MEAF6   Gene   UCSC   Ensembl
• Aliases: C1orf149, CENP-28, EAF6, NY-SAR-91
• Gene name: MYST/Esa1 associated factor 6
• Alternate names: chromatin modification-related protein MEAF6, Esa1p-associated factor 6 homolog, centromere protein 28, protein EAF6 homolog, sarcoma antigen NY-SAR-91,
• Gene location: 1p34.3 (37514765: 37489959)     Exons: 10     NC_000001.11
• Gene summary(Entrez): This gene encodes a nuclear protein involved in transcriptional activation. The encoded protein may form a component of several different histone acetyltransferase complexes. There is a pseudogene for this gene on chromosome 2. Alternative splicing result
• OMIM: 0

Protein Summary

• Protein general information: Q9HAF1  
  • Name: Chromatin modification related protein MEAF6 (MYST/Esa1 associated factor 6) (Esa1 associated factor 6 homolog) (Protein EAF6 homolog) (hEAF6) (Sarcoma antigen NY SAR 91)
  • Length: 191  
  • Mass: 21635
• Sequence:

  MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKN
  DRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGV
  KPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY

• Structural information:
  • Interpro: IPR015418  
  • STRING: ENSP00000362166
• Other Databases: GeneCards:  MEAF6  Malacards:  MEAF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043968	histone H2A acetylation	IBA	biological process
GO:0043981	histone H4-K5 acetylation	IBA	biological process
GO:0043982	histone H4-K8 acetylation	IBA	biological process
GO:0044154	histone H3-K14 acetylation	IBA	biological process
GO:0070776	MOZ/MORF histone acetyltransferase complex	IBA	cellular component
GO:1990467	NuA3a histone acetyltransferase complex	IBA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0035267	NuA4 histone acetyltransferase complex	IBA	cellular component
GO:0043983	histone H4-K12 acetylation	IBA	biological process
GO:0043994	histone acetyltransferase activity (H3-K23 specific)	IBA	contributes to
GO:1990468	NuA3b histone acetyltransferase complex	IBA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0070776	MOZ/MORF histone acetyltransferase complex	IDA	cellular component
GO:0070776	MOZ/MORF histone acetyltransferase complex	IDA	cellular component
GO:0044154	histone H3-K14 acetylation	IDA	biological process
GO:0000123	histone acetyltransferase complex	IEA	cellular component
GO:0016573	histone acetylation	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0043972	histone H3-K23 acetylation	IEA	biological process
GO:0043983	histone H4-K12 acetylation	IDA	biological process
GO:0043984	histone H4-K16 acetylation	IDA	NOT|biological process
GO:0043982	histone H4-K8 acetylation	IDA	biological process
GO:0043981	histone H4-K5 acetylation	IDA	biological process
GO:0043968	histone H2A acetylation	IDA	biological process
GO:0035267	NuA4 histone acetyltransferase complex	IDA	cellular component
GO:0035267	NuA4 histone acetyltransferase complex	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881