• Gene id: 64766

Gene Summary

• Gene Symbol: S100PBP   Gene   UCSC   Ensembl
• Aliases: S100PBPR
• Gene name: S100P binding protein
• Alternate names: S100P-binding protein, S100P binding protein 1,
• Gene location: 1p35.1 (32816766: 32858878)     Exons: 16     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that was originally identified by its interaction with S100 calcium-binding protein P. Expression of this protein has been reported to be associated with pancreatic ductal adenocarcinoma. Alternatively spliced transcript varian
• OMIM: 611889

Protein Summary

• Protein general information: Q96BU1  
  • Name: S100P binding protein (S100P binding protein Riken)
  • Length: 408  
  • Mass: 45582
  • Tissue specificity: Expressed in brain, spleen, and lung. Not detected in pancreas or liver. In pancreas, expressed predominantly in islet cells and to a lesser extent in acinar cells, but not expressed in ductal cells. Up-regulated in various pancreatic
• Sequence:

  MMCSRVPSEQSSGTSLLPKDGAPFSWDSLDEDGLDDSLLELSEGEEDDGDVNYTEEEIDALLKEDDPSYEQSSGE
  DDGGHVEKGERGSQILLDTPREKNSSYSLGPVAETPDLFKLPQLSTSSGHGPAHTKPLNRRSVLEKNLIKVTVAP
  FNPTVCDALLDKDETDSSKDTEKLSSLGEEMREDGLSPNESKLCTESEGISPNNSAWNGPQLSSSNNNFQQTVSD
  KNMPDSENPTSVFSRISDHSETPNMELSCRNGGSHKSSCEMRSLVVSTSSNKQDVLNKDSGKMKGHERRLGKVIP
  VLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQGISGELCALMDQVHHMQHSKWQHPSDLTTRNYAR
  RQKHLQRYSLTQWVDRNMRSHHRFQRLPDFSYS

• Structural information:
  • Interpro: IPR026097  
  • STRING: ENSP00000362574
• Other Databases: GeneCards:  S100PBP  Malacards:  S100PBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0048306	calcium-dependent protein binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0048306	calcium-dependent protein binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)