• Gene id: 64757

Gene Summary

• Gene Symbol: MTARC1   Gene   UCSC   Ensembl
• Aliases: MARC1, MOSC1
• Gene name: mitochondrial amidoxime reducing component 1
• Alternate names: mitochondrial amidoxime-reducing component 1, MOCO sulphurase C-terminal domain containing 1, MOSC domain-containing protein 1, mitochondrial, moco sulfurase C-terminal domain-containing protein 1, molybdenum cofactor sulfurase C-terminal domain-containing pr,
• Gene location: 1q41 (220786696: 220819658)     Exons: 11     NC_000001.11
• OMIM: 300081

Protein Summary

• Protein general information: Q5VT66  
  • Name: Mitochondrial amidoxime reducing component 1 (mARC1) (EC 1.7. . ) (Molybdenum cofactor sulfurase C terminal domain containing protein 1) (MOSC domain containing protein 1) (Moco sulfurase C terminal domain containing protein 1)
  • Length: 337  
  • Mass: 37499
• Sequence:

  MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCKGVPVS
  EAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCR
  VHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLN
  SRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQC
  DPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ

• Structural information:
  • Protein Domains: (187..33-)
    (/note="MOSC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00670"-)
  • Interpro: IPR005302  IPR005303  IPR011037  
  • Prosite: PS51340
  • PDB: 6FW2
  • PDBsum: 6FW2
  • STRING: ENSP00000355877
• Other Databases: GeneCards:  MTARC1  Malacards:  MTARC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030151	molybdenum ion binding	IBA	molecular function
GO:0042126	nitrate metabolic process	IBA	biological process
GO:0043546	molybdopterin cofactor binding	IBA	molecular function
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0008940	nitrate reductase activity	IBA	molecular function
GO:0030151	molybdenum ion binding	IDA	molecular function
GO:0043546	molybdopterin cofactor binding	IDA	molecular function
GO:0030151	molybdenum ion binding	IEA	molecular function
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0008940	nitrate reductase activity	IDA	molecular function
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0043546	molybdopterin cofactor binding	IDA	molecular function
GO:0042126	nitrate metabolic process	IDA	biological process
GO:0030151	molybdenum ion binding	IDA	molecular function
GO:0005739	mitochondrion	ISS	cellular component
GO:0051410	detoxification of nitrogen compound	NAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray