• Gene id: 64748

Gene Summary

• Gene Symbol: PLPPR2   Gene   UCSC   Ensembl
• Aliases: LPPR2, PRG4
• Gene name: phospholipid phosphatase related 2
• Alternate names: phospholipid phosphatase-related protein type 2, PRG-4, lipid phosphate phosphatase-related protein type 2, plasticity related gene 4, plasticity-related gene 4 protein,
• Gene location: 19p13.2 (132356725: 132261355)     Exons: 33     NC_000009.12

Protein Summary

• Protein general information: Q96GM1  
  • Name: Phospholipid phosphatase related protein type 2 (EC 3.1.3.4) (Lipid phosphate phosphatase related protein type 2) (Plasticity related gene 4 protein) (PRG 4)
  • Length: 343  
  • Mass: 36880
• Sequence:

  MAGGRPHLKRSFSIIPCFVFVESVLLGIVILLAYRLEFTDTFPVHTQGFFCYDSTYAKPYPGPEAASRVPPALVY
  ALVTAGPTLTILLGELARAFFPAPPSAVPVIGESTIVSGACCRFSPPVRRLVRFLGVYSFGLFTTTIFANAGQVV
  TGNPTPHFLSVCRPNYTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDAALCAYAVTYTAMYVT
  LVFRVKGSRLVKPSLCLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVHNFQSRPPSGRRLSP
  WEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTAPAVAT

• Structural information:
  • Interpro: IPR028679  IPR036938  IPR000326  
  • STRING: ENSP00000466898
• Other Databases: GeneCards:  PLPPR2  Malacards:  PLPPR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006644	phospholipid metabolic process	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0008195	phosphatidate phosphatase activity	IBA	molecular function
GO:0042577	lipid phosphatase activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016791	phosphatase activity	IBA	molecular function
GO:0046839	phospholipid dephosphorylation	IBA	biological process
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881