• Gene id: 64746

Gene Summary

• Gene Symbol: ACBD3   Gene   UCSC   Ensembl
• Aliases: GCP60, GOCAP1, GOLPH1, PAP7
• Gene name: acyl-CoA binding domain containing 3
• Alternate names: Golgi resident protein GCP60, PBR- and PKA-associated protein 7, PKA (RIalpha)-associated protein, acyl-Coenzyme A binding domain containing 3, golgi complex associated protein 1, 60kDa, golgi phosphoprotein 1, peripheral benzodiazepine receptor-associated prot,
• Gene location: 1q42.12 (226186740: 226144678)     Exons: 8     NC_000001.11
• Gene summary(Entrez): The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integr
• OMIM: 606809

Protein Summary

• Protein general information: Q9H3P7  
  • Name: Golgi resident protein GCP60 (Acyl CoA binding domain containing protein 3) (Golgi complex associated protein 1) (GOCAP1) (Golgi phosphoprotein 1) (GOLPH1) (PBR and PKA associated protein 7) (Peripheral benzodiazepine receptor associated protein PAP7) [C
  • Length: 528  
  • Mass: 60593
  • Tissue specificity: Ubiquitous, with highest expression in testis and ovary. {ECO
• Sequence:

  MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAEEARRL
  EQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALG
  NMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREEEERLRRE
  EEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQ
  QAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMW
  TRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSES
  SDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVY
  YTR

• Structural information:
  • Protein Domains: (83..17-)
    (/note="ACB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00573-)
    (384..52-)
    (/note="GOLD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00096"-)
  • Interpro: IPR022408  IPR000582  IPR035984  IPR014352  IPR009038   IPR036598  
  • Prosite: PS00880 PS51228 PS50866
  • PDB: 2N72 2N73 5LZ1 5LZ3 5LZ6 5TDQ 6HLN 6HLT 6HLV 6HLW 6HM8 6HMV
  • PDBsum: 2N72 2N73 5LZ1 5LZ3 5LZ6 5TDQ 6HLN 6HLT 6HLV 6HLW 6HM8 6HMV
  • DIP: 40673
  • STRING: ENSP00000355777
• Other Databases: GeneCards:  ACBD3  Malacards:  ACBD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IBA	cellular component
GO:0000139	Golgi membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000062	fatty-acyl-CoA binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006694	steroid biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0034237	protein kinase A regulatory subunit binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881