• Gene id: 647087

Gene Summary

• Gene Symbol: STMP1   Gene   UCSC   Ensembl
• Aliases: C7orf73, Mm47, PL-5283
• Gene name: short transmembrane mitochondrial protein 1
• Alternate names: short transmembrane mitochondrial protein 1, uncharacterized protein C7orf73,
• Gene location: 7q33 (135662513: 135676415)     Exons: 3     NC_000007.14
• OMIM: 611056

Protein Summary

• Protein general information: E0CX11  
  • Name: Short transmembrane mitochondrial protein 1
  • Length: 47  
  • Mass: 5265
• Sequence:

  MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPSA

• Structural information:
  • Interpro: IPR027854  
  • STRING: ENSP00000425996
• Other Databases: GeneCards:  STMP1  Malacards:  STMP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005746	mitochondrial respirasome	IBA	cellular component
GO:0005758	mitochondrial intermembrane space	ISS	cellular component
GO:0005741	mitochondrial outer membrane	ISS	cellular component
GO:1900227	positive regulation of NLRP3 inflammasome complex assembly	ISS	biological process
GO:0050718	positive regulation of interleukin-1 beta secretion	ISS	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)