• Gene id: 64693

Gene Summary

• Gene Symbol: CTAGE1   Gene   UCSC   Ensembl
• Aliases: CT21.1, CT21.2, CTAGE, CTAGE-1, CTAGE-2
• Gene name: cutaneous T cell lymphoma-associated antigen 1
• Alternate names: cTAGE family member 2, cancer/testis antigen 21.2, cancer/testis antigen family 21, member 1, cancer/testis antigen family 21, member 2, cutaneous T-cell lymphoma-associated antigen 2, protein cTAGE-2,
• Gene location: 18q11.2 (22417914: 22413598)     Exons: 1     NC_000018.10
• OMIM: 607288

Protein Summary

• Protein general information: Q96RT6  
  • Name: cTAGE family member 2 (Protein cTAGE 2) (Cancer/testis antigen 21.2) (CT21.2)
  • Length: 745  
  • Mass: 85282
  • Tissue specificity: Testis. Not found in tumor.
• Sequence:

  MRPDSHPYGFPWELVIRAAVAGFFAVLFLWRSFRSVTSRLYVRREKKFAVALSGLIEEKCKLLEKFSLVQKEYEG
  YEVESSLKNASFEKEATEAQSLEATCEKLNRFNSELVHEILCLEKELKEEKSKHSEQNELMADISKRIQSLEDES
  KSLKSQVAEAKMTFKRFQANEERLEIEIQDAWKENSELQESQKQLLQEAEVWKEQVSELIKQKRTFEDSKVHAEQ
  VLNDKENHIKTLTERLLKMKDGVAMLEEDVTDDDNLELEMNSESEDGAYLDNPPKGALKKLIHAAKLNASLKTLE
  GERNQIYIQLSEVDKTKEELTEHIKNLQTEQASLQSENTHFESENQKLQQKLKVMTELYQENEMKLYRKLIVEEK
  CRLEKEEKLSKVDEMISHATEELETYRKRAKDLKEFEKTIHFYQKKIILHEKKAHDNWSAAWTAERNLNDLRKEN
  AHNRQKLTEIEFKIKLLEKDPYGLDVPNTAFGRQHSPYGPSPLGWPSSETRASLYPPTLLEGPLRLSPLLPRGGG
  RGSRGPGNPPDHQITKERGESSCDRLTDPHRAPSDAGPLAPPWEQDYRMMFPPPGQSYPDSALPPQRQDRFYSNC
  ARLSGPAELRSFNMPSLDKMDGSMPSEMESSRNDTKDNLGNLKVPDSSLPAENEATGPGFVPPPLAPIRGLLFPV
  DTRGPFIRRGPPFPPPPPGTVFGASPDYFSPRDVPGPPRAPFAMRNVYLPRGFLPYRPPRPAFFPPAPTF

• Structural information:
  • STRING: ENSP00000375220
• Other Databases: GeneCards:  CTAGE1  Malacards:  CTAGE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0009306	protein secretion	IBA	biological process
GO:0070971	endoplasmic reticulum exit site	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0035459	vesicle cargo loading	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0009306	protein secretion	IBA	biological process
GO:0070971	endoplasmic reticulum exit site	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0035459	vesicle cargo loading	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881