• Gene id: 64689

Gene Summary

• Gene Symbol: GORASP1   Gene   UCSC   Ensembl
• Aliases: GOLPH5, GRASP65, P65
• Gene name: golgi reassembly stacking protein 1
• Alternate names: Golgi reassembly-stacking protein 1, Golgi peripheral membrane protein p65, Golgi phosphoprotein 5, Golgi reassembly and stacking protein 1, golgi reassembly stacking protein 1, 65kDa, golgi reassembly-stacking protein of 65 kDa,
• Gene location: 3p22.2 (39108362: 39096598)     Exons: 11     NC_000003.12
• Gene summary(Entrez): The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a c
• OMIM: 606867

Protein Summary

• Protein general information: Q9BQQ3  
  • Name: Golgi reassembly stacking protein 1 (Golgi peripheral membrane protein p65) (Golgi phosphoprotein 5) (GOLPH5) (Golgi reassembly stacking protein of 65 kDa) (GRASP65)
  • Length: 440  
  • Mass: 46482
• Sequence:

  MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMK
  TMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSDQILQESEDFF
  TLIESHEGKPLKLMVYNSKSDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQPPSYHKKPPGTPPPSALPLG
  APPPDALPPGPTPEDSPSLETGSRQSDYMEALLQAPGSSMEDPLPGPGSPSHSAPDPDGLPHFMETPLQPPPPVQ
  RVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSSSSHERGGEATWSGSEFEVSFLDSPG
  AQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE

• Structural information:
  • Protein Domains: (15..10-)
    1 (/note="PDZ-GRASP-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01212-)
    (111..19-)
    2 (/note="PDZ-GRASP-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01212"-)
  • Interpro: IPR024958  IPR007583  IPR036034  
  • Prosite: PS51865
  • PDB: 4REY 6G8T 6G8W
  • PDBsum: 4REY 6G8T 6G8W
  • STRING: ENSP00000313869
• Other Databases: GeneCards:  GORASP1  Malacards:  GORASP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0007030	Golgi organization	IBA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0061951	establishment of protein localization to plasma membrane	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:1904668	positive regulation of ubiquitin protein ligase activity	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006487	protein N-linked glycosylation	IEA	biological process
GO:0007030	Golgi organization	IEA	biological process
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0050774	negative regulation of dendrite morphogenesis	IMP	biological process
GO:0007030	Golgi organization	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881