• Gene id: 64598

Gene Summary

• Gene Symbol: MOSPD3   Gene   UCSC   Ensembl
• Aliases: CDS3, NET30
• Gene name: motile sperm domain containing 3
• Alternate names: motile sperm domain-containing protein 3,
• Gene location: 7q22.1 (100612161: 100615376)     Exons: 8     NC_000007.14
• Gene summary(Entrez): This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding diff
• OMIM: 609125

Protein Summary

• Protein general information: O75425  
  • Name: Motile sperm domain containing protein 3
  • Length: 235  
  • Mass: 25519
• Sequence:

  MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPA
  KYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDP
  APRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVL
  GLLTMVFLRT

• Structural information:
  • Protein Domains: (33..14-)
    (/note="MSP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00132"-)
  • Interpro: IPR013783  IPR000535  IPR008962  IPR016763  
  • Prosite: PS50202
  • STRING: ENSP00000377522
• Other Databases: GeneCards:  MOSPD3  Malacards:  MOSPD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0033149	FFAT motif binding	IBA	molecular function
GO:0061817	endoplasmic reticulum-plasma membrane tethering	IBA	biological process
GO:0090158	endoplasmic reticulum membrane organization	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007507	heart development	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray