• Gene id: 645832

Gene Summary

• Gene Symbol: SEBOX   Gene   UCSC   Ensembl
• Aliases: OG-9, OG9, OG9X
• Gene name: SEBOX homeobox
• Alternate names: homeobox protein SEBOX, homeobox OG-9, skin-, embryo-, brain- and oocyte-specific homeobox,
• Gene location: 17q11.2 (28365150: 28364267)     Exons: 3     NC_000017.11
• Gene summary(Entrez): Homeodomain proteins, such as SEBOX, play a key role in coordinating gene expression during development (Cinquanta et al., 2000 [PubMed 10922053]).[supplied by OMIM, Mar 2008]

Protein Summary

• Protein general information: Q9HB31  
  • Name: Homeobox protein SEBOX (Homeobox OG 9) (Skin , embryo , brain and oocyte specific homeobox)
  • Length: 190  
  • Mass: 20398
• Sequence:

  MPSPVDASSADGGSGLGSHRRKRTTFSKGQLLELERAFAAWPYPNISTHEHLAWVTCLPEAKVQVWFQKRWAKII
  KNRKSGILSPGSECPQSSCSLPDTLQQPWDPQMPGQPPPSSGTPQRTSVCRHSSCPAPGLSPRQGWEGAKAVAPW
  GSAGASEVHPSLERATPQTSLGSLSDLIYALAIVVNVDHS

• Structural information:
  • Interpro: IPR009057  IPR001356  IPR042223  
  • Prosite: PS50071
  • CDD: cd00086
  • STRING: ENSP00000444503
• Other Databases: GeneCards:  SEBOX  Malacards:  SEBOX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	ISA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0048477	oogenesis	IEA	biological process
GO:0009792	embryo development ending in birth or egg hatching	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq