• Gene id: 64582

Gene Summary

• Gene Symbol: GPR135   Gene   UCSC   Ensembl
• Aliases: HUMNPIIY20
• Gene name: G protein-coupled receptor 135
• Alternate names: G-protein coupled receptor 135, probable G-protein coupled receptor 135,
• Gene location: 14q23.1 (59465635: 59452772)     Exons: 6     NC_000014.9
• OMIM: 607970

Protein Summary

• Protein general information: Q8IZ08  
  • Name: G protein coupled receptor 135
  • Length: 494  
  • Mass: 51736
• Sequence:

  MEEPQPPRPPASMALLGSQHSGAPSAAGPPGGTSSAATAAVLSFSTVATAALGNLSDASGGGTAAAPGGGGLGGS
  GAAREAGAAVRRPLGPEAAPLLSHGAAVAAQALVLLLIFLLSSLGNCAVMGVIVKHRQLRTVTNAFILSLSLSDL
  LTALLCLPAAFLDLFTPPGGSAPAAAAGPWRGFCAASRFFSSCFGIVSTLSVALISLDRYCAIVRPPREKIGRRR
  ALQLLAGAWLTALGFSLPWELLGAPRELAAAQSFHGCLYRTSPDPAQLGAAFSVGLVVACYLLPFLLMCFCHYHI
  CKTVRLSDVRVRPVNTYARVLRFFSEVRTATTVLIMIVFVICCWGPYCFLVLLAAARQAQTMQAPSLLSVVAVWL
  TWANGAINPVIYAIRNPNISMLLGRNREEGYRTRNVDAFLPSQGPGLQARSRSRLRNRYANRLGACNRMSSSNPA
  SGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTSL

• Structural information:
  • Interpro: IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000378548
• Other Databases: GeneCards:  GPR135  Malacards:  GPR135

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005768	endosome	IDA	cellular component
GO:1990763	arrestin family protein binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R