• Gene id: 64581

Gene Summary

• Gene Symbol: CLEC7A   Gene   UCSC   Ensembl
• Aliases: BGR, CANDF4, CD369, CLECSF12, DECTIN1, SCARE2
• Gene name: C-type lectin domain containing 7A
• Alternate names: C-type lectin domain family 7 member A, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12, C-type lectin superfamily member 12, DC-associated C-type lectin 1, beta-glucan receptor, dectin-1, dendritic cell-associate,
• Gene location: 12p13.2 (10130268: 10116776)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunorec
• OMIM: 606264

Protein Summary

• Protein general information: Q9BXN2  
  • Name: C type lectin domain family 7 member A (Beta glucan receptor) (C type lectin superfamily member 12) (Dendritic cell associated C type lectin 1) (DC associated C type lectin 1) (Dectin 1)
  • Length: 247  
  • Mass: 27,627
• Sequence:

  MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAIWRSNSG
  SNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQ
  LGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHV
  SVIYDQLCSVPSYSICEKKFSM

• Structural information:
  • Protein Domains: C-type (127-242)
  • Interpro: IPR001304  IPR016186  IPR016187  IPR033992  
  • Prosite: PS50041
  • CDD: cd03593
  • DIP: 61730
  • STRING: ENSP00000302569
• Other Databases: GeneCards:  CLEC7A  Malacards:  CLEC7A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002221	pattern recognition receptor signaling pathway	IEA	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0002366	leukocyte activation involved in immune response	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006910	phagocytosis, recognition	IDA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0008037	cell recognition	IDA	biological process
GO:0008329	signaling pattern recognition receptor activity	IDA	molecular function
GO:0009756	carbohydrate mediated signaling	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0030246	carbohydrate binding	IDA	molecular function
GO:0042110	T cell activation	TAS	biological process
GO:0042287	MHC protein binding	NAS	molecular function
GO:0042832	defense response to protozoan	NAS	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0071226	cellular response to molecule of fungal origin	IEA	biological process
GO:0002221	pattern recognition receptor signaling pathway	IEA	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0002366	leukocyte activation involved in immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006910	phagocytosis, recognition	IDA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0008037	cell recognition	IDA	biological process
GO:0008329	signaling pattern recognition receptor activity	IDA	molecular function
GO:0009756	carbohydrate mediated signaling	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	IDA	molecular function
GO:0042110	T cell activation	TAS	biological process
GO:0042287	MHC protein binding	NAS	molecular function
GO:0042832	defense response to protozoan	NAS	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0071226	cellular response to molecule of fungal origin	IEA	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006910	phagocytosis, recognition	IDA	biological process
GO:0008037	cell recognition	IDA	biological process
GO:0008329	signaling pattern recognition receptor activity	IDA	molecular function
GO:0009756	carbohydrate mediated signaling	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0030246	carbohydrate binding	IDA	molecular function
GO:0042110	T cell activation	TAS	biological process
GO:0042287	MHC protein binding	NAS	molecular function
GO:0042832	defense response to protozoan	NAS	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome
hsa04625	C-type lectin receptor signaling pathway
hsa05152	Tuberculosis

Diseases

Associated diseases	References
Inflammatory bowel disease	GAD: 19915667
Spermatogenesis/testicular development	MIK: 15685348
Spermatogenesis/testicular development	MIK: 15685348
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 15685348
Testicular development	MIK: 15685348
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15685348	Male infertility, spermatogenesis/testicular development				Male infertility
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray