• Gene id: 64518

Gene Summary

• Gene Symbol: TEKT3   Gene   UCSC   Ensembl
• Gene name: tektin 3
• Alternate names: tektin-3, testicular microtubules-related protein,
• Gene location: 17p12 (15343681: 15303810)     Exons: 13     NC_000017.11
• Gene summary(Entrez): This gene product belongs to the tektin family of proteins. Tektins comprise a family of filament-forming proteins that are coassembled with tubulins to form ciliary and flagellar microtubules. The exact function of this gene is not known. [provided by Re
• OMIM: 612683

Protein Summary

• Protein general information: Q9BXF9  
  • Name: Tektin 3
  • Length: 490  
  • Mass: 56,636
• Sequence:

  MERVGCTLTTTYAHPRPTPTNFLPAISTMASSYRDRFPHSNLTHSLSLPWRPSTYYKVASNSPSVAPYCTRSQRV
  SENTMLPFVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERV
  NDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDT
  ILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESW
  AKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQT
  EMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVH
  IKATLEYDLAVKANSLYIDQEKCMSMRKSYPNTLRLVGFC

• Structural information:
  • Interpro: IPR000435  
  • STRING: ENSP00000343995
• Other Databases: GeneCards:  TEKT3  Malacards:  TEKT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002080	acrosomal membrane	ISS	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0030317	flagellated sperm motility	ISS	biological process
GO:0036126	sperm flagellum	ISS	cellular component
GO:0060271	cilium assembly	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0080154	regulation of fertilization	ISS	biological process
GO:0002080	acrosomal membrane	IEA	cellular component
GO:0002080	acrosomal membrane	ISS	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0030317	flagellated sperm motility	ISS	biological process
GO:0036126	sperm flagellum	IEA	cellular component
GO:0036126	sperm flagellum	ISS	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0060271	cilium assembly	IEA	biological process
GO:0060271	cilium assembly	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0080154	regulation of fertilization	IEA	biological process
GO:0080154	regulation of fertilization	ISS	biological process
GO:0002080	acrosomal membrane	ISS	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0030317	flagellated sperm motility	ISS	biological process
GO:0036126	sperm flagellum	ISS	cellular component
GO:0060271	cilium assembly	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0080154	regulation of fertilization	ISS	biological process

Diseases

Associated diseases	References
Varicocele	MIK: 25999357
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 25999357

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25999357	Varicocele			27 (17 men diagnosed with bilateral varicocele, 10 proven fertile men as healthy controls)	Male infertility
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)