• Gene id: 6446

Gene Summary

• Gene Symbol: SGK1   Gene   UCSC   Ensembl
• Aliases: SGK
• Gene name: serum/glucocorticoid regulated kinase 1
• Alternate names: serine/threonine-protein kinase Sgk1, Sgk1 variant i3, serine/threonine protein kinase SGK,
• Gene location: 6q23.2 (134318111: 134169245)     Exons: 18     NC_000006.12
• Gene summary(Entrez): This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell sur
• OMIM: 602958

Protein Summary

• Protein general information: O00141  
  • Name: Serine/threonine protein kinase Sgk1 (EC 2.7.11.1) (Serum/glucocorticoid regulated kinase 1)
  • Length: 431  
  • Mass: 48942
  • Tissue specificity: Expressed in most tissues with highest levels in the pancreas, followed by placenta, kidney and lung. Isoform 2 is strongly expressed in brain and pancreas, weaker in heart, placenta, lung, liver and skeletal muscle. {ECO
• Sequence:

  MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSP
  PPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVL
  LKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKP
  ENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
  NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPN
  VSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL

• Structural information:
  • Protein Domains: (98..35-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (356..43-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR011009  IPR017892  IPR000719  IPR017441   IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108
  • PDB: 2R5T 3HDM 3HDN
  • PDBsum: 2R5T 3HDM 3HDN
  • DIP: 42464
  • STRING: ENSP00000356832
• Other Databases: GeneCards:  SGK1  Malacards:  SGK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0015459	potassium channel regulator activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060453	regulation of gastric acid secretion	TAS	biological process
GO:0051090	regulation of DNA-binding transcription factor activity	TAS	biological process
GO:0042127	regulation of cell population proliferation	TAS	biological process
GO:0030334	regulation of cell migration	TAS	biological process
GO:0017081	chloride channel regulator activity	TAS	molecular function
GO:0008217	regulation of blood pressure	TAS	biological process
GO:0007616	long-term memory	TAS	biological process
GO:0005246	calcium channel regulator activity	TAS	molecular function
GO:0070294	renal sodium ion absorption	TAS	biological process
GO:0050790	regulation of catalytic activity	TAS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0032411	positive regulation of transporter activity	TAS	biological process
GO:0017080	sodium channel regulator activity	TAS	molecular function
GO:0015459	potassium channel regulator activity	TAS	molecular function
GO:0001558	regulation of cell growth	TAS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006814	sodium ion transport	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0004712	protein serine/threonine/tyrosine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04150	mTOR signaling pathway
hsa04068	FoxO signaling pathway
hsa04960	Aldosterone-regulated sodium reabsorption

Diseases

Associated diseases	References
Hypertension	PMID:16221215
Granulosa cell tumor	PMID:11994539
serous cystadenocarcinoma	PMID:11994539
mucinous cystadenocarcinoma	PMID:11994539
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq