• Gene id: 64432

Gene Summary

• Gene Symbol: MRPS25   Gene   UCSC   Ensembl
• Aliases: MRP-S25, RPMS25
• Gene name: mitochondrial ribosomal protein S25
• Alternate names: 28S ribosomal protein S25, mitochondrial, S25mt, mitochondrial 28S ribosomal protein S25, mitochondrial small ribosomal subunit protein mS25,
• Gene location: 3p25.1 (15065314: 15042250)     Exons: 14     NC_000003.12
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611987

Protein Summary

• Protein general information: P82663  
  • Name: 28S ribosomal protein S25, mitochondrial (MRP S25) (S25mt) (Mitochondrial small ribosomal subunit protein mS25)
  • Length: 173  
  • Mass: 20116
• Sequence:

  MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPF
  LRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCP
  SLVPLPKEMRGKYKAALKADAQD

• Structural information:
  • Interpro: IPR040049  IPR007741  IPR036249  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000253686
• Other Databases: GeneCards:  MRPS25  Malacards:  MRPS25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)