• Gene id: 64429

Gene Summary

• Gene Symbol: ZDHHC6   Gene   UCSC   Ensembl
• Aliases: DHHC-6, DHHC6, ZNF376
• Gene name: zinc finger DHHC-type palmitoyltransferase 6
• Alternate names: palmitoyltransferase ZDHHC6, transmembrane protein H4, zinc finger DHHC domain-containing protein 6, zinc finger DHHC-type containing 6, zinc finger protein 376,
• Gene location: 10q25.2 (23755025: 23758934)     Exons: 7     NC_000016.10
• OMIM: 618715

Protein Summary

• Protein general information: Q9H6R6  
  • Name: Palmitoyltransferase ZDHHC6 (EC 2.3.1.225) (Transmembrane protein H4) (Zinc finger DHHC domain containing protein 6) (DHHC 6) (Zinc finger protein 376)
  • Length: 413  
  • Mass: 47663
• Sequence:

  MGTFCSVIKFENLQELKRLCHWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIMLINWTVMILYNYFNA
  MFVGPGFVPLGWKPEISQDTMYLQYCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGYQNHASFTLFLLL
  APLGCIHAAFIFVMTMYTQLYHRLSFGWNTVKIDMSAARRDPLPIVPFGLAAFATTLFALGLALGTTIAVGMLFF
  IQMKIILRNKTSIESWIEEKAKDRIQYYQLDEVFVFPYDMGSRWRNFKQVFTWSGVPEGDGLEWPVREGCHQYSL
  TIEQLKQKADKRVRSVRYKVIEDYSGACCPLNKGIKTFFTSPCTEEPRIQLQKGEFILATRGLRYWLYGDKILDD
  SFIEGVSRIRGWFPRKCVEKCPCDAETDQAPEGEKKNR

• Structural information:
  • Protein Domains: (99..14-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067-)
    (313..39-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR001594  IPR001452  
  • Prosite: PS50216 PS50002
  • STRING: ENSP00000358413
• Other Databases: GeneCards:  ZDHHC6  Malacards:  ZDHHC6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0018345	protein palmitoylation	IDA	biological process
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0018345	protein palmitoylation	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0010636	positive regulation of mitochondrial fusion	IMP	biological process
GO:0043543	protein acylation	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881