• Gene id: 64428

Gene Summary

• Gene Symbol: CIAO3   Gene   UCSC   Ensembl
• Aliases: HPRN, IOP1, LET1L, NAR1, NARFL, PRN
• Gene name: cytosolic iron-sulfur assembly component 3
• Alternate names: cytosolic iron-sulfur assembly component 3, LET1 like/JFP15, cytosolic Fe-S cluster assembly factor NARFL, iron-only hydrogenase-like protein 1, nuclear prelamin A recognition factor like, protein related to Narf,
• Gene location: 16p13.3 (740996: 729764)     Exons: 12     NC_000016.10
• OMIM: 168470

Protein Summary

• Protein general information: Q9H6Q4  
  • Name: Cytosolic iron sulfur assembly component 3 (Cytosolic Fe S cluster assembly factor NARFL) (Iron only hydrogenase like protein 1) (IOP1) (Nuclear prelamin A recognition factor like protein) (Protein related to Narf)
  • Length: 476  
  • Mass: 53020
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MASPFSGALQLTDLDDFIGPSQECIKPVKVEKRAGSGVAKIRIEDDGSYFQINQDGGTRRLEKAKVSLNDCLACS
  GCITSAETVLITQQSHEELKKVLDANKMAAPSQQRLVVVSVSPQSRASLAARFQLNPTDTARKLTSFFKKIGVHF
  VFDTAFSRHFSLLESQREFVRRFRGQADCRQALPLLASACPGWICYAEKTHGSFILPHISTARSPQQVMGSLVKD
  FFAQQQHLTPDKIYHVTVMPCYDKKLEASRPDFFNQEHQTRDVDCVLTTGEVFRLLEEEGVSLPDLEPAPLDSLC
  SGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHVAEVTYKPLRNKDFQEVTLEKEGQVLLHFAMAYGFRNIQN
  LVQRLKRGRCPYHYVEVMACPSGCLNGGGQLQAPDRPSRELLQHVERLYGMVRAEAPEDAPGVQELYTHWLQGTD
  SECAGRLLHTQYHAVEKASTGLGIRW

• Structural information:
  • Interpro: IPR009016  IPR004108  IPR003149  
  • STRING: ENSP00000251588
• Other Databases: GeneCards:  CIAO3  Malacards:  CIAO3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IDA	biological process
GO:0032364	oxygen homeostasis	IDA	biological process
GO:0016226	iron-sulfur cluster assembly	IBA	biological process
GO:0097361	CIA complex	IBA	cellular component
GO:0097361	CIA complex	IDA	cellular component
GO:0097361	CIA complex	IDA	cellular component
GO:0097361	CIA complex	IDA	cellular component
GO:0016226	iron-sulfur cluster assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0016226	iron-sulfur cluster assembly	IEA	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0010468	regulation of gene expression	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881