• Gene id: 64426

Gene Summary

• Gene Symbol: SUDS3   Gene   UCSC   Ensembl
• Aliases: SAP45, SDS3
• Gene name: SDS3 homolog, SIN3A corepressor complex component
• Alternate names: sin3 histone deacetylase corepressor complex component SDS3, 45 kDa Sin3-associated polypeptide, sin3A-associated protein, 45kDa, suppressor of defective silencing 3 protein homolog,
• Gene location: 12q24.23 (83157094: 83187450)     Exons: 16     NC_000011.10
• Gene summary(Entrez): SDS3 is a subunit of the histone deacetylase (see HDAC1; MIM 601241)-dependent SIN3A (MIM 607776) corepressor complex (Fleischer et al., 2003 [PubMed 12724404]).[supplied by OMIM, Mar 2008]
• OMIM: 608250

Protein Summary

• Protein general information: Q9H7L9  
  • Name: Sin3 histone deacetylase corepressor complex component SDS3 (45 kDa Sin3 associated polypeptide) (Suppressor of defective silencing 3 protein homolog)
  • Length: 328  
  • Mass: 38136
  • Tissue specificity: Expressed in various cancer cell ines. {ECO
• Sequence:

  MSAAGLLAPAPAQAGAPPAPEYYPEEDEELESAEDDERSCRGRESDEDTEDASETDLAKHDEEDYVEMKEQMYQD
  KLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLETEQVERNYIKEKKAAVKEFEDKKVELKENL
  IAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNK
  LKSPKRPASPSSPEHLPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVR
  KTSDSTKMRIYLGQLQRGLFVIRRRSAA

• Structural information:
  • Interpro: IPR013907  
  • STRING: ENSP00000443988
• Other Databases: GeneCards:  SUDS3  Malacards:  SUDS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070822	Sin3-type complex	IBA	cellular component
GO:0004407	histone deacetylase activity	IBA	contributes to
GO:0042826	histone deacetylase binding	IBA	molecular function
GO:0016575	histone deacetylation	IBA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0004407	histone deacetylase activity	IDA	contributes to
GO:0016575	histone deacetylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0021762	substantia nigra development	HEP	biological process
GO:0042826	histone deacetylase binding	ISS	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016580	Sin3 complex	ISS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)